DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and CG10725

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:343 Identity:80/343 - (23%)
Similarity:115/343 - (33%) Gaps:127/343 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLALA--LGSAWAND---NPCQDVRIPGFVCM--NCTTLGYCIRDATGSWETISMLGCQSEYN 66
            |.||||.  |||..|.|   |.|.:|....||..  ||:....|:.:.....|      |.::|.
  Fly     5 LTLLALVALLGSCSAADGDVNVCSNVVNNLFVPQVGNCSKYFLCMNEIAVPRE------CPTDYY 63

  Fly    67 FYCSDEGTFGCTFQSQC----QVPKRGPFSCQQAGLFPDPYD--CRRYHECSDQSVDTP--RICS 123
            |...|:         :|    :|...|  ||:..||....||  |.:|..|.|   .||  |.||
  Fly    64 FDARDQ---------ECVPLMEVECIG--SCKNRGLSSFCYDRTCTKYVLCFD---GTPVIRQCS 114

  Fly   124 NGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEG 188
            :|..|:.||..|..|:..: |:..  .|||:..     ||:..|           .|...:|   
  Fly   115 DGLQYNALTDRCDYPQYVD-CVDN--LCSRNNN-----PDDIVF-----------IPSKARC--- 157

  Fly   189 FVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPK 253
                                         |:|..           |:||..:|..|.:|.|.:|.
  Fly   158 -----------------------------DKYYI-----------CMDGLPQVQNCTSGLQYNPS 182

  Fly   254 ILTCVTDRIYQC-------------------SDFEILSCPNVST--------KDEYCICIDHQLQ 291
            ..:|.......|                   :|.|   ||:...        :|.|..|::.:..
  Fly   183 TQSCDFPSKVNCTVESLQRNILPFARAPPRLADIE---CPSEGAHFIAHQKRQDAYYYCLNGRGV 244

  Fly   292 IYSCPMGQYFNAETRKCQ 309
            ...|..|..|:|:..:|:
  Fly   245 TLDCTPGLVFDAKREECR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 19/53 (36%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 11/52 (21%)
CBM_14 83..134 CDD:279884 20/54 (37%)
CBM_14 150..192 CDD:279884 14/95 (15%)
ChtBD2 216..264 CDD:214696 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.