DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and Muc68D

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:281 Identity:56/281 - (19%)
Similarity:96/281 - (34%) Gaps:70/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GCTFQSQCQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTPRICSNG--AGYSTL---TGT- 134
            |.:..|..:.|..|...|       .|...::....|..:..||:..:.|  |..|||   ||| 
  Fly  1247 GDSGNSSSESPPEGATPC-------TPNAPKKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGTT 1304

  Fly   135 ---------C------VLPRESEQCIQEQFTCSRSGQVGGWAPDNRYF----YVCVNDTANSLYP 180
                     |      :..|:.:.| .:.:.|.....:.|..|.|.:|    .||       .:|
  Fly  1305 PGHQEDRTDCSNMPNGIFLRDFQSC-NKYYVCLNGKAIAGHCPRNLHFDIKRKVC-------NFP 1361

  Fly   181 LMMKCHEGFVFNSYSCVP-DTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTC 244
            .::.|.......:.:..| ||.|....:::.:...: .|...|.      .:..|.:|......|
  Fly  1362 SLVDCPLDEAPENVTKKPSDTESTPDCKSLRNGAYV-RDPKSCS------RFYVCANGRAIPRQC 1419

  Fly   245 PAGFQIDPKILTCVTDRIYQCSDFE-------------ILSCP---------NVSTKDEYCICID 287
            |.|...|.|...|....:.|||..|             :..|.         :|...::|.:|:.
  Fly  1420 PQGLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDCTKVKEDTRFGDVKQHNKYYVCLK 1484

  Fly   288 HQLQIYSCPMGQYFNAETRKC 308
            .:..::.|..|.:|:..::||
  Fly  1485 GKAVLHYCSPGNWFDLRSQKC 1505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 14/70 (20%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 11/59 (19%)
CBM_14 1388..1440 CDD:279884 10/58 (17%)
ChtBD2 1459..1505 CDD:214696 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.