DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and obst-B

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:369 Identity:73/369 - (19%)
Similarity:109/369 - (29%) Gaps:173/369 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPVCLILLALALGSAWANDNPCQDVRIPGFVCMNCTTLGYCIRDATGSWETISMLGCQSEYNFYC 69
            |.:|:..||||:|                   :..|.    .:::.|.:.     |..|::....
  Fly     9 VKICIFALALAVG-------------------LTATK----AQESRGGFR-----GSNSQFRVGP 45

  Fly    70 SDEGTFGCTFQSQCQVPKRGPFSCQQA-------------------------GLFPDPYDCRRYH 109
            ...       .||..:|.|.....|:|                         |.:||...|.:|:
  Fly    46 GHP-------PSQRHLPPRNRDPVQEASVVPKSKQTAAEKEYEPTEECPEPNGFYPDSKQCDKYY 103

  Fly   110 ECSDQSVDTPRICSNGA---GYSTLTGTCVLP-------RESEQCIQEQFTCSR-SGQVGGWAP- 162
            .|.| .|.|.|:|::|.   .||.:...|.||       |...|..|....|.| :|..|...| 
  Fly   104 ACLD-GVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQTPQPSLHCPRKNGYFGHEKPG 167

  Fly   163 --DNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFR 225
              |..||                                                          
  Fly   168 ICDKFYF---------------------------------------------------------- 174

  Fly   226 TSEIEYCKCVDGELEVMTCPAGFQIDPK-----------ILTCVTDRIYQCSDFEILSCPNVS-- 277
                    ||||:..::|||||...:||           :..|.::.::   |||   ||.|:  
  Fly   175 --------CVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCKSEDVF---DFE---CPKVNES 225

  Fly   278 ---TKDEYC---------ICIDHQL-QIYSCPMGQYFNAETRKC 308
               |...|.         :|::..| :...|.:||.|:.|...|
  Fly   226 IAVTHPRYADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 20/84 (24%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 17/50 (34%)
CBM_14 156..204 CDD:279884 18/113 (16%)
CBM_14 233..278 CDD:279884 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.