DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and Mur2B

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:224 Identity:54/224 - (24%)
Similarity:84/224 - (37%) Gaps:77/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 QSEYNFYCSDEGTFGCTFQSQCQ---------------VPKRGPF----SCQQAGLFPDPYDCRR 107
            |.:|.:.|..:    |...|:|:               ||:..|.    .||:.|.||.|:||:.
  Fly   103 QQQYYYVCKPD----CVIFSKCRGLESFNASSGRCVQHVPQHRPDHRPPQCQKEGRFPHPHDCKV 163

  Fly   108 YHECSDQSVDTPRI--CSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAPDNRYFYVC 170
            |:.| |::...|.:  |..|..:|.:...| ||  .:||...:.:.|     |.:.|.|      
  Fly   164 YYRC-DKNRTQPWLFACPAGTIFSPVERKC-LP--GDQCPSTEISDS-----GSYIPQN------ 213

  Fly   171 VNDTANSLYPLMMKCHEGFVFNS-------YSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTS- 227
                ....:|   :|.|...|.|       |:|          :..||.|.:.. |::||...| 
  Fly   214 ----CELKFP---ECAEEGTFRSPTDCALYYTC----------RLQESGTYLQT-RFKCPGSNSF 260

  Fly   228 --EIEYCK------CVD---GELEVMTCP 245
              |.:.|:      |.|   |.::|...|
  Fly   261 DLERKLCRPRSEVDCFDFVPGPVQVPYAP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 17/51 (33%)
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 6/36 (17%)
CBM_14 150..197 CDD:279884 17/50 (34%)
CBM_14 221..275 CDD:279884 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.