DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32302 and R02F2.4

DIOPT Version :9

Sequence 1:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:286 Identity:67/286 - (23%)
Similarity:103/286 - (36%) Gaps:69/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PGFVCMNCTTLGYCIRDATG---SWETISMLG-CQSEYNFYCSDEGTFGCTFQSQCQVPKRGPFS 92
            |.|  ::|:|  ..|.|.|.   ||:  .|:. |......||..:|...   :|:|   ....||
 Worm   144 PRF--LSCST--PLIYDPTNKKCSWK--GMIDECSQVSGEYCESDGNIS---KSEC---SNVFFS 196

  Fly    93 CQQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQV 157
            |.:.        ......|....|..|.|.|           |..|:....|.::.......|:|
 Worm   197 CSEG--------IAHRRNCPANLVFNPAISS-----------CDWPKNVMDCSEKSEKPQNCGEV 242

  Fly   158 GGWAPDNR---YFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDR 219
            .|:....|   .|..|.|.     .|::|.|.:|.:|:..:.:.|.........:||...|.|  
 Worm   243 DGYFSFGRCSSSFSACTNG-----IPIVMFCPDGLMFSEKNQMCDYEWNVDECDLESSGFMEN-- 300

  Fly   220 YQCPFRTSE-IEYCKCVDGELEVMTCPAGFQIDPKILTCVTDR--IYQCSDFEI-----LSC--P 274
                ::.|| :..|..:|..|..:.|      .|::|:|...|  |::|....:     |.|  |
 Worm   301 ----YKASEALTPCTNMDNGLYALDC------TPRVLSCQNGRENIFECPPSLVFNENSLICDYP 355

  Fly   275 NVSTKDEYCICIDHQLQIYSCPMGQY 300
            ..|.|   | |::..|.|....:|.|
 Worm   356 ETSLK---C-CMEDALLIRDASIGTY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 7/49 (14%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 8/24 (33%)
CBM_14 185..229 CDD:279884 12/68 (18%)
ChtBD2 240..283 CDD:214696 12/47 (26%)
CBM_14 310..361 CDD:279884 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.