DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13807 and RAMAC

DIOPT Version :9

Sequence 1:	NP_647706.1	Gene:	CG13807 / 38290	FlyBaseID:	FBgn0035323	Length:	170	Species:	Drosophila melanogaster
Sequence 2:	NP_113640.1	Gene:	RAMAC / 83640	HGNCID:	31022	Length:	118	Species:	Homo sapiens

Alignment Length:	152	Identity:	41/152 - (26%)
Similarity:	55/152 - (36%)	Gaps:	61/152 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 FADRFTDDDPEFMAHCSKPVPEPPIVENWMGGGGGGGGFQGGGGGGHPYHNRYNGHRRGGGDRGW 90
            ||.|||::|.|:..:..:|...|||||.|                          :.|.||::
Human    15 FASRFTENDKEYQEYLKRPPESPPIVEEW--------------------------NSRAGGNQ-- 51

  Fly    91 QRRGGAGYHNNQDRGFRDNRRNNRYDHIDRRNRYEGGGGSGGSGGYKRSHDHN--QRNDTP---- 149
            :.||.....|.|.|| ||||.....|  :|.|::.|           ||..:|  |....|
Human    52 RNRGNRLQDNRQFRG-RDNRWGWPSD--NRSNQWHG-----------RSWGNNYPQHRQEPYYPQ 102

  Fly   150 -------NNEPPMKVRRDYGNF 164
                   |..||      ||.:
Human   103 QYGHYGYNQRPP------YGYY 118

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG13807	NP_647706.1	RAM	21..106	CDD:291966	22/79 (28%)
RAMAC	NP_113640.1	Interaction with RNMT. /evidence=ECO:0000269\|PubMed:22099306	2..55		17/67 (25%)
		RAM	10..87	CDD:317693	32/113 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	29..118		34/136 (25%)
		RNMT-activating domain. /evidence=ECO:0000269\|PubMed:27422871	36..42		4/5 (80%)
		RNA-binding. /evidence=ECO:0000269\|PubMed:22099306	56..118		22/81 (27%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR48168
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	3	2.970