DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13807 and ramac

DIOPT Version :9

Sequence 1:NP_647706.1 Gene:CG13807 / 38290 FlyBaseID:FBgn0035323 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001037960.1 Gene:ramac / 733725 XenbaseID:XB-GENE-969014 Length:116 Species:Xenopus tropicalis


Alignment Length:116 Identity:35/116 - (30%)
Similarity:45/116 - (38%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ESCELEFADRFTDDDPEFMAHCSKPVPEPPIVENWMGGGGGGGGFQGGGGGGHPYHNRY--NGHR 82
            |..|..|..|||.:|.|:..:..:...:|||||:|.             .|.....:||  |.|.
 Frog     9 ELYEKMFEQRFTANDKEYQEYLKREQDQPPIVEDWK-------------MGNQRNTDRYRDNRHH 60

  Fly    83 RG-GGDRGWQR--------RGGAGYHNNQDRGFRDNRRNNRYDHIDRRNRY 124
            || .|.:.|..        |||.|...||.|..|.|.:...|.|.....|:
 Frog    61 RGWDGRQNWSSNSYNQSYGRGGWGNSYNQYRQDRHNYQQGHYTHNPSNQRF 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13807NP_647706.1 RAM 21..106 CDD:291966 29/95 (31%)
ramacNP_001037960.1 Interaction with RNMT. /evidence=ECO:0000250|UniProtKB:Q9BTL3 1..55 16/58 (28%)
RAM 11..83 CDD:373747 24/84 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..116 27/94 (29%)
RNMT-activating domain. /evidence=ECO:0000250|UniProtKB:Q9BTL3 36..42 4/5 (80%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9BTL3 56..116 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48168
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.