DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13807 and Ramac

DIOPT Version :9

Sequence 1:NP_647706.1 Gene:CG13807 / 38290 FlyBaseID:FBgn0035323 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001120923.1 Gene:Ramac / 293058 RGDID:1310022 Length:119 Species:Rattus norvegicus


Alignment Length:151 Identity:45/151 - (29%)
Similarity:57/151 - (37%) Gaps:58/151 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FADRFTDDDPEFMAHCSKPVPEPPIVENWMGGGGGGGGFQGGGGGGHPYHNRYNGHRRGGGDRGW 90
            ||:|||.||.|:..:..:|...|||||.|....||                  |...||    .|
  Rat    15 FANRFTQDDKEYQEYLKRPPESPPIVEEWNSRAGG------------------NQRNRG----NW 57

  Fly    91 QRRGGAGYHNNQDRGFRDNRRNNRYDHIDRRNRYEGGGGSGGSGGYKR------------SHDHN 143
            .:      .|.|.|| |||||....|  :|.|::.  |.|.|:..|.:            .:.||
  Rat    58 LQ------DNRQFRG-RDNRRGWPSD--NRSNQWH--GRSWGNNNYPQQRPEPYYQPNCPQYGHN 111

  Fly   144 QRNDTPNNEPPMKVRRDYGNF 164
            ||       ||      ||.:
  Rat   112 QR-------PP------YGYY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13807NP_647706.1 RAM 21..106 CDD:291966 24/79 (30%)
RamacNP_001120923.1 RAM 11..87 CDD:405907 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR48168
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.