DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and GCNT3

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_004742.1 Gene:GCNT3 / 9245 HGNCID:4205 Length:438 Species:Homo sapiens


Alignment Length:338 Identity:85/338 - (25%)
Similarity:150/338 - (44%) Gaps:53/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-LESKFPNIRL 305
            |:|.....||:.:.::.: :....|||:|:|||:::|.:||||:....:::.:: :.|.|||:.:
Human   125 SKEEVEFPIAYSMVIHEK-IENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFI 188

  Fly   306 ARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVK 370
            |.|....::...|.:...|.||||||||:..|.:.:|...:|||:|:..::|..|....|||.::
Human   189 ASKLVRVVYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSME 253

  Fly   371 G-----HGRETQKFIQKQGLDKTFVECDT-HMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYV-T 428
            .     |.....|:..:       |..|| |:........|..:.:..|:.::..||.||.:| .
Human   254 SEVPPKHKETRWKYHFE-------VVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLK 311

  Fly   429 HPREDDELLQALLKLFRHTLLPAESFFHTVLR----------NTKHCTSYVDNNLHVTNWKRKQG 483
            :|:.     |.|::..:.|..|.|..:.|:.|          :.|:..|.:.:...:..|:..:|
Human   312 NPKS-----QQLIEWVKDTYSPDEHLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEG 371

  Fly   484 --------CKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWL 540
                    ..|...|....|.....|.   :|     ..|.....|.||:|.::...|..|||:|
Human   372 DIDKGAPYAPCSGIHQRAICVYGAGDL---NW-----MLQNHHLLANKFDPKVDDNALQCLEEYL 428

  Fly   541 YGPYTSEYANLHG 553
                  .|..::|
Human   429 ------RYKAIYG 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 70/278 (25%)
Xylo_C 537..710 CDD:289306 5/17 (29%)
GCNT3NP_004742.1 Branch 133..401 CDD:308216 71/288 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.