DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and WSC4

DIOPT Version :10

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_011835.1 Gene:WSC4 / 856357 SGDID:S000001020 Length:605 Species:Saccharomyces cerevisiae


Alignment Length:52 Identity:17/52 - (32%)
Similarity:24/52 - (46%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 CVELCLQSGYPYAGVQYGRECFCGYDPPPKASKLPDSSCNTKCLGNAKEICG 217
            |...|  :|:.:|.|| |..|:|....|...:.:.|  |:..|.|...|.||
Yeast    52 CSNNC--AGHQFAIVQ-GFMCWCSDSEPSTQTSVGD--CSGTCPGYGYEDCG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:460348 17/52 (33%)
Branch 250..504 CDD:452742
Xylo_C 537..709 CDD:463618
WSC4NP_011835.1 WSC 25..109 CDD:214616 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.