DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment oxt and WSC4

DIOPT Version :9

Sequence 1:	NP_647705.1	Gene:	oxt / 38288	FlyBaseID:	FBgn0015360	Length:	876	Species:	Drosophila melanogaster
Sequence 2:	NP_011835.1	Gene:	WSC4 / 856357	SGDID:	S000001020	Length:	605	Species:	Saccharomyces cerevisiae

Alignment Length:	52	Identity:	17/52 - (32%)
Similarity:	24/52 - (46%)	Gaps:	5/52 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   166 CVELCLQSGYPYAGVQYGRECFCGYDPPPKASKLPDSSCNTKCLGNAKEICG 217
            |...|  :|:.:|.|| |..|:|....|...:.:.|  |:..|.|...|.||
Yeast    52 CSNNC--AGHQFAIVQ-GFMCWCSDSEPSTQTSVGD--CSGTCPGYGYEDCG 98

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
oxt	NP_647705.1	WSC	138..218	CDD:280068	17/52 (33%)
		Branch	250..503	CDD:280621
		Xylo_C	537..710	CDD:289306
WSC4	NP_011835.1	WSC	25..109	CDD:214616	17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4157
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900