DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and WSC3

DIOPT Version :10

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_014536.1 Gene:WSC3 / 854046 SGDID:S000005465 Length:556 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:33/127 - (25%)
Similarity:54/127 - (42%) Gaps:35/127 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 GYYSSSKTSNSPAKCVELCLQSGYPYAGVQY---------------GRECFCGYDPP--PKASKL 199
            |.||::...::     .|.|::.|.|..|.|               |.:|:||....  ...:|.
Yeast    44 GCYSAADIQSA-----GLSLKNSYIYQSVSYCQNQCPESAVVALFNGSDCYCGNSVSFLTSLTKS 103

  Fly   200 PDSSCNTKCLGNAKEICGGFYAMNIY---ETGIAKF----------TAQLAATTPSEETKRV 248
            .||:|.|||.|...::|||...||:|   ||.::..          |:.:.:||.|..:.::
Yeast   104 TDSNCGTKCSGWPYQMCGGSSYMNVYVNAETFVSSVESSSSKEGSSTSYMPSTTSSLSSAQI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:460348 22/82 (27%)
Branch 250..504 CDD:452742
Xylo_C 537..709 CDD:463618
WSC3NP_014536.1 WSC 39..132 CDD:214616 27/92 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.