DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT1G71070

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_565009.1 Gene:AT1G71070 / 843447 AraportID:AT1G71070 Length:395 Species:Arabidopsis thaliana


Alignment Length:316 Identity:85/316 - (26%)
Similarity:136/316 - (43%) Gaps:47/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 QVHRLLKALYAPEHVYYIHVD-ERQDYLYRKLL-ELES-----KFPNIRLARKRFSTIWGGASLL 320
            ::.|||.|:|.|.:.|.||:. |..|.....|| :|:|     .|.|:.:..|.......|||.:
plant    62 RISRLLLAVYHPRNRYLIHLGAEATDAERLALLSDLKSVPAVNAFGNVDVLGKVDRLSENGASKI 126

  Fly   321 TMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVD-FLSANPGRNFVKGHG----RETQKFI 380
            ...|..:..||:.:..|::.|.||..|:|:.|.|.|.. |.|.|...||:....    :|:|: |
plant   127 ASTLHAVSILLKLDPTWNWFIELSALDYPLITQDDLSHVFASVNRSLNFIDHTSDLAWKESQR-I 190

  Fly   381 QKQGLDKT-FVECDTHMWRIGD-RKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKL 443
            :...:|.. ::...|.::...: |..|...:|..||.|:.|||||:.|.....  |.|.:.||..
plant   191 KPIVVDPALYLARRTQLFTATEKRPTPDAFKVFTGSPWIVLSRPFLEYCIFGW--DNLPRILLMY 253

  Fly   444 FRHTLLPAESFFHTVLRNT-KHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKP--- 504
            |.:.:|..|.:||||:.|. :...:.|:.:|....|.                  ||...:|   
plant   254 FNNVILSEECYFHTVICNAPEFSNTTVNGDLRYMIWD------------------SPPKMEPHFL 300

  Fly   505 --EDWPRLQATEQKSLFFARKF---EPVINQAVLLQLEEWLYGPYTSEYANLHGYW 555
              .|:.::   .|....|||:|   :||::......|:...|......:.:.|..|
plant   301 TISDFDQM---AQSGAAFARQFKKDDPVLDMVDREILKRGRYRVTPGAWCSSHSSW 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 72/254 (28%)
Xylo_C 537..710 CDD:289306 3/19 (16%)
AT1G71070NP_565009.1 Branch 49..309 CDD:280621 74/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.