Sequence 1: | NP_647705.1 | Gene: | oxt / 38288 | FlyBaseID: | FBgn0015360 | Length: | 876 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_115772.2 | Gene: | Kremen1 / 84035 | MGIID: | 1933988 | Length: | 473 | Species: | Mus musculus |
Alignment Length: | 273 | Identity: | 66/273 - (24%) |
---|---|---|---|
Similarity: | 98/273 - (35%) | Gaps: | 90/273 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 PPHAQARVQPPARTKLTAQ-----QLGFQPEC------DILAREAISALQRAKTKDCREHIAQIA 110
Fly 111 CAIQAGRFYAPQLRSSCPAG-----------NHTANVS--------------------------- 137
Fly 138 LGCFKDEKDRRLLAGYYSSSKTSN--SPAKCVELCLQSGYPYAGVQYGRECFCGYDPPP-KASKL 199
Fly 200 PDSSCNTKCLGNAKEICGGFYAMNIYETGI----AKFTAQLAATTPSEE------TKRV------ 248
Fly 249 -----RIAFLLTL 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
oxt | NP_647705.1 | WSC | 138..218 | CDD:280068 | 28/82 (34%) |
Branch | 250..503 | CDD:280621 | 4/7 (57%) | ||
Xylo_C | 537..710 | CDD:289306 | |||
Kremen1 | NP_115772.2 | KR | 31..114 | CDD:238056 | 15/93 (16%) |
WSC | 119..200 | CDD:280068 | 28/83 (34%) | ||
CUB | 214..320 | CDD:238001 | 12/46 (26%) | ||
Essential for apoptotic activity. /evidence=ECO:0000269|PubMed:26206087 | 414..473 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4157 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |