DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT1G03520

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_171851.1 Gene:AT1G03520 / 839471 AraportID:AT1G03520 Length:447 Species:Arabidopsis thaliana


Alignment Length:397 Identity:94/397 - (23%)
Similarity:163/397 - (41%) Gaps:94/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 RIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVD------ERQ--------DYLYRKLLELESK 299
            |:|:|::.......::.|.|:|:|.|.:.|.:|:|      ||.        |..:|   |:|  
plant   102 RLAYLISGTKGDSHRMMRTLQAVYHPRNQYVLHLDLEAPPRERMELAMSVKTDPTFR---EME-- 161

  Fly   300 FPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANP 364
              |:|:..:.....:.|.:::...||.:..||:.:.|||:.:|||.||:|:.|.|.|: ::.:|.
plant   162 --NVRVMAQSNLVTYKGPTMIACTLQAVSILLRESLHWDWFLNLSASDYPLVTQDDLL-YVFSNL 223

  Fly   365 GR--NFVKGHGRETQKFIQKQGLDKTFVECDTHM-------WRIGDRKLPAGIQVDGGSDWVALS 420
            .|  ||::.......|..|:  .....|:...::       |....|.||...::..||.|:.|:
plant   224 SRNVNFIENMQLTGWKLNQR--AKSIIVDPALYLSKKSDIAWTTQRRSLPNSFRLFTGSAWIMLT 286

  Fly   421 RPFV-----GYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKH-CTSYVDNNLHVTNWK 479
            |.|:     |:...||       .:|..:.:.:...|.:||||:.|:|. ..:.:.::||...| 
plant   287 RSFLEYCIWGWDNFPR-------TILMYYTNFVSSPEGYFHTVICNSKEFINTAIGHDLHYIAW- 343

  Fly   480 RKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATE------QKSLFFARKFEPVINQAVLLQLEE 538
                                 |..|:..||..:.:      :....|||||..  |...|.::::
plant   344 ---------------------DSPPKQHPRSLSLKDFDNMVKSKAPFARKFHK--NDPALDKIDK 385

  Fly   539 WLYGPYTSEYANLHGYW---QSLYHHEDVHGSGDDLARSIGDSVMRLSARQAKLYPLELIELTHY 600
            .|.| .|..:|  .|.|   .|...::.....|||.....|....||.            ||...
plant   386 ELLG-RTHRFA--PGGWCVGSSANGNDQCSVQGDDSVLKPGPGSERLQ------------ELVQT 435

  Fly   601 LHRDQYK 607
            |..::::
plant   436 LSSEEFR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 67/281 (24%)
Xylo_C 537..710 CDD:289306 16/74 (22%)
AT1G03520NP_171851.1 Branch 32..446 CDD:391737 94/397 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.