DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT5G15050

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_197009.1 Gene:AT5G15050 / 831357 AraportID:AT5G15050 Length:434 Species:Arabidopsis thaliana


Alignment Length:389 Identity:103/389 - (26%)
Similarity:166/389 - (42%) Gaps:76/389 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 RIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-------LESKFPNIRLA 306
            |:|:|::.:....:.:.|.|.|||.|.:.|.:|:|.......|..|.       |..:|.|:|:.
plant    87 RLAYLISGSSGDGQMLKRTLMALYHPNNQYVVHLDRESSPEERLDLSGFVANHTLFQRFQNVRMI 151

  Fly   307 RKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANP-GRNFV- 369
            .|.....:.|.:::...|.....||:....||:.||||.||:|:.|.|.|:...|..| ..||: 
plant   152 VKANFVTYRGPTMVANTLHAAAILLREGGDWDWFINLSASDYPLVTQDDLLHTFSYLPRDLNFID 216

  Fly   370 --------KGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGY 426
                    :.|  ..:..|...||..: .:.|. .|....|.:|...::..||.|:.||||||.|
plant   217 HTSNIGWKESH--RAKPIIIDPGLYMS-KKADV-FWVSQKRSMPTAFKLFTGSAWMMLSRPFVDY 277

  Fly   427 VTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCT-SYVDNNLHVTNWKR--KQGCKCQY 488
            .....  |.|.:.:|..:.:.|...|.:||||:.|.:..| :.|:::||..:|..  ||      
plant   278 FIWGW--DNLPRIVLMYYANFLSSPEGYFHTVICNAREFTNTTVNSDLHFISWDNPPKQ------ 334

  Fly   489 KHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKF---EPVINQ--AVLLQLEEWLYGPYTSEY 548
                     .|:....:|:.|:..:...   |||||   |||:::  :.||.....:..|     
plant   335 ---------HPHHLTLDDFQRMVDSNAP---FARKFRRDEPVLDKIDSELLFRSHGMVTP----- 382

  Fly   549 ANLHGYWQSLYHHEDVHGSGDDLARSIGD-SVMR--LSARQAKLYPLELIE--LTHYLHRDQYK 607
                |.|..     ....:|.|....||| ||::  |.|::        ||  :|:.|..:.::
plant   383 ----GGWCI-----GTRENGSDPCAVIGDTSVIKPGLGAKR--------IEKLITYLLSTENFR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 74/272 (27%)
Xylo_C 537..710 CDD:289306 16/76 (21%)
AT5G15050NP_197009.1 Branch 18..434 CDD:391737 103/389 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 1 0.900 - - OOG6_102671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.