DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT4G27480

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001119069.1 Gene:AT4G27480 / 828857 AraportID:AT4G27480 Length:421 Species:Arabidopsis thaliana


Alignment Length:411 Identity:97/411 - (23%)
Similarity:166/411 - (40%) Gaps:83/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SSCNTKCLGNAKEICGGFYAMNIYETG-----IAKFTAQLAATTPSEETKRVRIAFLLTLNGRAL 261
            :|.|...|.:.:.|....::.|:..|.     .|:.....::..|..:....|..:|::.:...|
plant    27 ASFNMGLLSSVRSINSLIFSYNLSTTNETRVEFAESKINQSSHPPPVQPSLPRFGYLVSGSRGDL 91

  Fly   262 RQVHRLLKALYAPEHVYYIHVD------ER--------QDYLYRKLLELESKFPNIRLARKRFST 312
            ..:.|:|:.||.|.:.|.:|:|      ||        ||.::       |...|:.:..|....
plant    92 ESLWRVLRTLYHPRNQYVVHLDLESPAEERLELAKRVSQDPVF-------SDVGNVHMITKANLV 149

  Fly   313 IWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVD-FLSANPGRNFVKGHG--- 373
            .:.|.:::...|.....||:.:..||:.||||.||:|:.|.|.|:| |...:...||: .|.   
plant   150 TYRGPTMVANTLHACAILLKQSKEWDWFINLSASDYPLVTQDDLIDTFSGLDRNLNFI-DHSSKL 213

  Fly   374 -----RETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPRED 433
                 :..:..|...||..| .:.|. .|....|.:|...::..||.|:.|||.||.|.....  
plant   214 GWKEEKRAKPLIIDPGLYST-KKSDV-FWVTPRRTMPTAFKLFTGSAWMVLSRSFVEYCIWGW-- 274

  Fly   434 DELLQALLKLFRHTLLPAESFFHTVLRNT-KHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGC 497
            |.|.:.||..:.:.|...|.:||||:.|. ::.::.::::||..:|.|                 
plant   275 DNLPRTLLMYYTNFLSTPEGYFHTVICNAPEYSSTVLNHDLHFISWDR----------------- 322

  Fly   498 SPNDFKPEDWPR---LQATEQ---KSLFFARKFEPVINQAVLLQLEEWLYGPYTSEYANLHGYWQ 556
                 .|:..||   :..||:   ....|:|||..  |...|.::::.|.|.....:.  .|.| 
plant   323 -----PPKQHPRALTINDTERMIASGSAFSRKFRH--NDPALDKIDKELLGRGNGNFT--PGGW- 377

  Fly   557 SLYHHEDVHGSGDDLARSIGD 577
                     .:|:.....:||
plant   378 ---------CAGEPKCSRVGD 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068 4/15 (27%)
Branch 250..503 CDD:280621 70/276 (25%)
Xylo_C 537..710 CDD:289306 7/41 (17%)
AT4G27480NP_001119069.1 PLN03183 1..421 CDD:178725 97/411 (24%)
Branch 80..340 CDD:280621 75/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 1 0.900 - - OOG6_102671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.