DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT4G03340

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_192243.1 Gene:AT4G03340 / 827969 AraportID:AT4G03340 Length:448 Species:Arabidopsis thaliana


Alignment Length:411 Identity:107/411 - (26%)
Similarity:176/411 - (42%) Gaps:96/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LAATTPSEETKRVRIAFLLT-LNGRALRQVHRLLKALYAPEHVYYIHVD------ER-------- 285
            |.:|..|..::..|:|:|:: ..|.:||.: |.|:|:|.|.:.|.:|:|      ||        
plant    90 LNSTLDSTSSEVPRLAYLISGTKGDSLRMM-RTLQAVYHPRNQYVLHLDLEAPPKERLELAMSVK 153

  Fly   286 QDYLYRKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPV 350
            .|..:|   |:|    |:|:..:.....:.|.:::...||.:..||:.:..||:.||||.||:|:
plant   154 SDQTFR---EVE----NVRVMSQSNLVTYKGPTMIACTLQAVAILLKESLDWDWFINLSASDYPL 211

  Fly   351 KTLDKLVDFLSANPGR--NFVKGH--------GRETQKFIQKQGL---DKTFVECDTHMWRIGDR 402
            .|.|.:: ::.||..|  ||:: |        .:..:..|...||   .||.:     .|....|
plant   212 VTQDDML-YVFANLSRNVNFIE-HMKLTGWKLNQRAKSIIVDPGLYLSKKTEI-----AWTTQHR 269

  Fly   403 KLPAGIQVDGGSDWVALSRPF-----VGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNT 462
            .||....:..||.||.|:|.|     :|:...||       .:|..:.:.:...|.:|||::.||
plant   270 SLPTSFTLFTGSAWVVLTRSFLEYSILGWDNFPR-------TILMYYTNFVSSPEGYFHTLICNT 327

  Fly   463 KHCTS-YVDNNLHVTNW--KRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKF 524
            :...| .:.::||...|  ..||               .||....:|:.::..::..   |||||
plant   328 EEFKSTAIGHDLHYIAWDYPPKQ---------------HPNSLSMKDFDKMVKSKAP---FARKF 374

  Fly   525 EPVINQAVLLQLEEWLYGPYTSEYANLHGYW---QSLYHHEDVHGSGDDLARSIGDSVMRLSARQ 586
            ..  |..||.:::..|.| .|..:::  |.|   .|....:.....|||.|...|....||.   
plant   375 HK--NDPVLDKIDRELLG-RTHRFSS--GAWCIGSSENGADPCSVRGDDSALKPGPGAERLK--- 431

  Fly   587 AKLYPLELIELTHYLHRDQYK 607
                     ||...|..|:::
plant   432 ---------ELLQTLLSDEFR 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 77/288 (27%)
Xylo_C 537..710 CDD:289306 17/74 (23%)
AT4G03340NP_192243.1 Branch 33..447 CDD:391737 107/411 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 1 0.900 - - OOG6_102671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.