DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and UNE7

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_187019.1 Gene:UNE7 / 821186 AraportID:AT3G03690 Length:378 Species:Arabidopsis thaliana


Alignment Length:416 Identity:103/416 - (24%)
Similarity:169/416 - (40%) Gaps:111/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 FYAMNIYETGIAKFTAQLAATTPSEETKRVR-----IAFLLTLNGRALRQVHRLLKALYAPEHVY 278
            |..:.|..|....||:....:.|.|..:...     .|:|::.:.....::.|||::||...:.|
plant    18 FSLLYIIPTTKTLFTSSKIPSLPLESNQNSNSTLPCFAYLISASKGDAGKLKRLLRSLYHRRNHY 82

  Fly   279 YIHVD-ERQDYLYRKLLELESKFP------NIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWH 336
            .||:| |..:..:.:::...:..|      |:.:..|.....:.|.::|...|..|..||:. ..
plant    83 LIHLDLEAPEEEHLEMIRFVAGEPLFQPEGNVMIVGKPNLVTYRGPTMLATTLHAMALLLRC-CR 146

  Fly   337 WDFVINLSESDFPVKTLDKLVDFLSANP-GRNFVKGHGRETQKFIQKQG-----------LDKTF 389
            ||:.||||.||:|:.|.|.|:...|..| ..||::...|...| :.|:|           |:|:.
plant   147 WDWFINLSASDYPLVTQDDLIYAFSELPRDLNFIQHTSRLGWK-MNKRGKPIIIDPGLYSLNKSE 210

  Fly   390 VECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPF-----VGYVTHPREDDELLQALLKLFRHTLL 449
            :     .|....|.||...::..||.|..|||||     :||       |.|.:.||..:.:.:.
plant   211 I-----WWVSNQRSLPTSFKLFTGSAWTFLSRPFAEYCIIGY-------DNLPRTLLLYYTNFVS 263

  Fly   450 PAESFFHTVLRNT---KHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQ 511
            ..|.:|.|::.|:   |:.|  |:::||...|                      |..|:..|::.
plant   264 SPEGYFQTLICNSDEFKNTT--VNHDLHYIAW----------------------DNPPKQHPKIL 304

  Fly   512 ATE--QKSLF----FARKF---EPVINQ--AVLLQLEEWLYGPYTSEYANLHGYWQSLYHHEDVH 565
            .|.  :|.:.    |||||   :||:|:  ..:|:.:..|                         
plant   305 GTRDYRKMVMSNRPFARKFKSNDPVLNRIDREILRRKRKL------------------------- 344

  Fly   566 GSGDDL-----ARSIGDSVMRLSARQ 586
            ||..||     ||.:...:|||..|:
plant   345 GSKPDLGPGPGARRLKSLLMRLLLRR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 72/279 (26%)
Xylo_C 537..710 CDD:289306 11/55 (20%)
UNE7NP_187019.1 Branch 27..378 CDD:421497 100/407 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.