DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT3G15350

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_566506.1 Gene:AT3G15350 / 820766 AraportID:AT3G15350 Length:424 Species:Arabidopsis thaliana


Alignment Length:335 Identity:95/335 - (28%)
Similarity:155/335 - (46%) Gaps:58/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 MNIYETGIAKFTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVD--- 283
            ::..|:.:|:.|..|    |.|: |..|.|:|::.:...:.::.|.|:|:|.|.:.|.:|:|   
plant    58 LDFAESKVARQTRVL----PHED-KLPRFAYLVSGSKGDVEKLWRTLRAVYHPRNQYVVHLDLES 117

  Fly   284 ---ER--------QDYLYRKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHW 337
               ||        .|.:|       ||..|:.:..|.....:.|.:::...|.....||:.|.:|
plant   118 PVNERLELASRINNDPMY-------SKTGNVYMITKANLVTYKGPTMVANTLHACAVLLKRNANW 175

  Fly   338 DFVINLSESDFPVKTLDKLV-DFLSANPGRNFVKGH----GRETQKFIQKQGLDKTFV---ECDT 394
            |:.||||.||:|:.|.|.|: .|.:.:...||:: |    |.:.:|..|...:|....   :.|.
plant   176 DWFINLSASDYPLVTQDDLLHTFSTLDRNLNFIE-HTSQLGWKEEKRAQPLMIDPGLYLLNKSDI 239

  Fly   395 HMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVL 459
            : |....|.||...::..||.|:|||||||.|.....  |.|.:.||..:.:.:...|.:|.||:
plant   240 Y-WVTPRRSLPTAFKLFTGSAWMALSRPFVEYCIWGW--DNLPRTLLMYYTNFVSSPEGYFQTVI 301

  Fly   460 RNT-KHCTSYVDNNLHVTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARK 523
            .|. :...:.|:::||..:|.....   |:.||:     |.||..|..|        ....||||
plant   302 CNVPEFAKTAVNHDLHYISWDNPPQ---QHPHVL-----SLNDTMPMIW--------SGAAFARK 350

  Fly   524 F---EPVINQ 530
            |   :.|:|:
plant   351 FRRDDEVLNK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 78/275 (28%)
Xylo_C 537..710 CDD:289306
AT3G15350NP_566506.1 PLN03183 1..424 CDD:178725 95/335 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 1 0.900 - - OOG6_102671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.