DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and AT2G37585

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_565866.1 Gene:AT2G37585 / 818335 AraportID:AT2G37585 Length:384 Species:Arabidopsis thaliana


Alignment Length:289 Identity:79/289 - (27%)
Similarity:133/289 - (46%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LAATTPSEETKRV-------------RIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVD-ERQ 286
            |::..||:.:..:             |.|:|:|......::|.|||||::.|.:.|.:|:| |..
plant    32 LSSRKPSDSSSGLAPNRNLATKSTIPRFAYLVTGTKGDGKRVKRLLKAIHHPRNYYLLHLDLEAS 96

  Fly   287 DYLYRKLLELESKFPNIRLARKRFSTIW----------GGASLLTMLLQCMEDLLQSNWHWDFVI 341
            |   .:.:|| :|:  :|..:|:|..:.          .|.::|...|..:..||:....||:.|
plant    97 D---EERMEL-AKY--VRSEKKKFENVMVMGLADLVTEKGPTMLASTLHGVAILLKKAKDWDWFI 155

  Fly   342 NLSESDFPVKTLDKLVDFLSANPG-RNFVKGHG----RETQK-----------FIQKQGLDKTFV 390
            |||.||:|:...|.::...|..|. .||::...    :|.|:           .::|.|:     
plant   156 NLSASDYPLMPQDDILHIFSYLPRYLNFIEHTSNIGWKENQRARPIIIDPGFYHLKKSGV----- 215

  Fly   391 ECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFV-----GYVTHPREDDELLQALLKLFRHTLLP 450
                 .|....|.|||..::..||..|||:|||:     |:       |.|.:.||..:.:.||.
plant   216 -----FWAKERRSLPASFKLFMGSTSVALTRPFLEFCIWGW-------DNLPRTLLMYYTNFLLS 268

  Fly   451 AESFFHTVLRNTK-HCTSYVDNNLHVTNW 478
            :|.:|.||:.|.| :..:.|:::||.|.|
plant   269 SEGYFQTVVCNNKDYQNTTVNHDLHYTKW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 75/262 (29%)
Xylo_C 537..710 CDD:289306
AT2G37585NP_565866.1 Branch 59..316 CDD:280621 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2682
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2713
orthoMCL 1 0.900 - - OOG6_102671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.