DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and gcnt4b.1

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_017208421.2 Gene:gcnt4b.1 / 798652 ZFINID:ZDB-GENE-091118-69 Length:442 Species:Danio rerio


Alignment Length:404 Identity:107/404 - (26%)
Similarity:165/404 - (40%) Gaps:71/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SGYPYAGVQYGRECFCGYDPPP----------KASKLPDSSCNTKCLGNAKEICGGFYAMNIYET 227
            |..|....:||..|...|:..|          |.....:.:..|  :.||...|..|.:...|: 
Zfish    55 SEMPRLTAKYGINCARIYEMEPVEVAKTLVIRKQKSYVEPTDET--IVNATSDCDQFVSSLGYD- 116

  Fly   228 GIAKFTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQ--DYLY 290
                      |...:|..:...:|:.|.:: |....|.|||:|:|.|.::|.||.|.:.  |::.
Zfish   117 ----------AIQVTESEREFPLAYSLVVH-RNAALVERLLRAVYVPHNIYCIHYDRKSSTDFML 170

  Fly   291 RKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDK 355
             .:..|....||:.:|.|.....:.|.|.|...|.|:.|||.|...|.:||||...|||::|..:
Zfish   171 -AMNGLARCMPNVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAE 234

  Fly   356 LVDFLSANPGRNFV--KGHGRETQKFIQKQGL-DKTFVECDTHMWRIGDRKLPA--GIQVDGGSD 415
            ||..|....|||.|  |..|.:.:::.....| :|.|...:|.: ...|:|.|.  .|::..||.
Zfish   235 LVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPV-STSDKKRPPPYDIEMFVGSA 298

  Fly   416 WVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLR---------NTKHCTSYVDN 471
            :..|||.|| |..|   ...|.:..|.....|..|.|.|:.|::|         .::...|.:.:
Zfish   299 YFTLSREFV-YFVH---WSYLARNFLAWSEDTFSPDEHFWATLVRVPGVPGEVPRSEADISELIS 359

  Fly   472 NLHVTNWKRKQG---CKCQYKHVVDWC--GCSPNDFKPEDWPRLQATEQKSL-----FFARKFEP 526
            ...:..|...:|   .:|...||...|  |               |.|.:.|     :||.|.:|
Zfish   360 KTRLVKWSAFEGRLYPRCTGVHVRKICIYG---------------AAELRWLLNYGHWFANKVDP 409

  Fly   527 VINQAVLLQLEEWL 540
            .::..::..|||.|
Zfish   410 KVDPVLIECLEEKL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068 12/54 (22%)
Branch 250..503 CDD:280621 80/273 (29%)
Xylo_C 537..710 CDD:289306 3/4 (75%)
gcnt4b.1XP_017208421.2 Branch 129..396 CDD:332239 82/288 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.