DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment oxt and KREMEN2

DIOPT Version :9

Sequence 1:	NP_647705.1	Gene:	oxt / 38288	FlyBaseID:	FBgn0015360	Length:	876	Species:	Drosophila melanogaster
Sequence 2:	NP_757384.1	Gene:	KREMEN2 / 79412	HGNCID:	18797	Length:	462	Species:	Homo sapiens

Alignment Length:	141	Identity:	40/141 - (28%)
Similarity:	58/141 - (41%)	Gaps:	10/141 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   138 LGCFKDEKDRRLLAGYYSSSKTSNSPAKCVELCLQSGYPYAGVQYGRECFCGYDPPPKASKL-PD 201
            ||||.|......|:| .|.:.|..:...|:..|...||..|||:.|..||||.:......:| |.
Human   125 LGCFVDSGAPPALSG-PSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPA 188

  Fly   202 SSCNTKCLGNAKEICGGFYAMNIYETGIAKFTAQLAATT--------PSEETKRVRIAFLLTLNG 258
            :.|:..|.|:..::|||...:.:||..:........|..        |.|.......::.|...|
Human   189 TDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPG 253

  Fly   259 RALRQVHRLLK 269
            .||....||.:
Human   254 AALELTFRLFE 264

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
oxt	NP_647705.1	WSC	138..218	CDD:280068	27/80 (34%)
		Branch	250..503	CDD:280621	6/20 (30%)
		Xylo_C	537..710	CDD:289306
KREMEN2	NP_757384.1	KR	35..119	CDD:238056
		WSC	124..205	CDD:280068	27/80 (34%)
		CUB	219..324	CDD:238001	9/46 (20%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	328..352
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4157
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900