DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Gcnt3

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_082363.2 Gene:Gcnt3 / 72077 MGIID:1919327 Length:437 Species:Mus musculus


Alignment Length:333 Identity:87/333 - (26%)
Similarity:148/333 - (44%) Gaps:55/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-LESKFPNIRL 305
            |:|.....||:.:.::.: :....|||:|:|.|::||.:|:|::....:::.:. :.|.|||:.:
Mouse   125 SKEEASFPIAYSMVVHEK-IENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSCFPNVFI 188

  Fly   306 ARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVK 370
            |.|..|.::...|.:...|.||||||||...|.:::|...:|||:||..::|..|....|:|.::
Mouse   189 ASKLVSVVYASWSRVQADLNCMEDLLQSPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSME 253

  Fly   371 G-----HGRETQKFIQKQGLDKTFVECDT-HMWRIGDRKLPA--GIQVDGGSDWVALSRPFVGYV 427
            .     |.:...|:        .:...|| ||  ...||.|.  .:.:..|:.::..||.|:.:|
Mouse   254 SEVPPPHKKSRWKY--------HYEVTDTLHM--TSKRKTPPPNNLTMFTGNAYMVASRDFIEHV 308

  Fly   428 ---THPRE----------DDELLQALLKLFRHTLLPAESFFH-----TVLRNTKHCTSYVDNNLH 474
               :..|:          .||.|.|.|:  |.:.:|.....|     :.:|.....|.:.|:...
Mouse   309 FSNSKARQLIEWVKDTYSPDEHLWATLQ--RASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGD 371

  Fly   475 VTNWKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEW 539
            :.|......|...::..|  |.....|        |....|.....|.||:|.::..||..|||:
Mouse   372 IENGAPYTSCSGIHQRAV--CVYGSGD--------LHWILQNHHLLANKFDPKVDDNVLQCLEEY 426

  Fly   540 L-----YG 542
            |     ||
Mouse   427 LRHKAIYG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 71/279 (25%)
Xylo_C 537..710 CDD:289306 5/11 (45%)
Gcnt3NP_082363.2 Branch 133..400 CDD:367100 72/289 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.