DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Gcnt1

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_071612.1 Gene:Gcnt1 / 64043 RGDID:621370 Length:428 Species:Rattus norvegicus


Alignment Length:314 Identity:80/314 - (25%)
Similarity:143/314 - (45%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-LESKFPNIRLARKRFSTI 313
            ||:.:.::.: :..:.|||:|:|.|::.|.||||.:.:..:...:: :.|.|.|:.:|.:..|.:
  Rat   123 IAYSIVVHHK-IDMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVV 186

  Fly   314 WGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQK 378
            :...|.:...|.||:||.:.|.:|.::|||...|||:||..::|..|.:..|.|.:     ||:|
  Rat   187 YASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKSFTGENSL-----ETEK 246

  Fly   379 F--IQKQGLDKTFVECDTHMWRIGDRKL--PAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQA 439
            .  .:::...|.:...|..:...|..|.  |....:..||.:..::|.:||||.    :::.:|.
  Rat   247 MPPNKEERWKKRYTVVDGKLTNTGVVKAQPPLKTPLFSGSAYFVVTREYVGYVL----ENKNIQK 307

  Fly   440 LLKLFRHTLLPAESFFHTVLR----------NTKHCTSYVDNNLHVTNWKRKQG--------CKC 486
            .::..:.|..|.|..:.|:.|          :.|:..|.::.......|:..:|        ..|
  Rat   308 FMEWAQDTYSPDEFLWATIQRIPEVPGSLPSSHKYDLSDMNAVARFVKWQYFEGDVSNGAPYPPC 372

  Fly   487 QYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWL 540
            ...||...|.....|.   .|     ..:|..|||.||:..::...|..|||.|
  Rat   373 SGVHVRSVCVFGVGDL---SW-----MLRKHHFFANKFDMDVDPFALQCLEEHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 68/275 (25%)
Xylo_C 537..710 CDD:289306 3/4 (75%)
Gcnt1NP_071612.1 Branch 123..391 CDD:396855 69/285 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.