DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and GCNT4

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001353666.1 Gene:GCNT4 / 51301 HGNCID:17973 Length:453 Species:Homo sapiens


Alignment Length:352 Identity:90/352 - (25%)
Similarity:152/352 - (43%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 NIYETGIAKFTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQD 287
            :||:| :..:..:|.    |:|.|...||:.|.::..|: .|.||:.|:|...::|.||.|.:..
Human   111 DIYQT-LRGYAQKLV----SKEEKSFPIAYSLVVHKDAI-MVERLIHAIYNQHNIYCIHYDRKAP 169

  Fly   288 YLYRKLL-ELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVK 351
            ..::..: .|...|.||.:|.|..:..:...|.|...|.|:.|||:|:..|.:||||...|||:|
Human   170 DTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCLSDLLKSSIQWKYVINLCGQDFPLK 234

  Fly   352 TLDKLVDFLSANPGRNF---VKGHGRETQKFIQKQGLDKT---FVECDTHMWRIGDRKLPAGIQV 410
            :..:||..|....|.|.   ||....:.::|.....|.:.   :|:..... .|.....|..||:
Human   235 SNFELVSELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVKLPIRT-NISKEAPPHNIQI 298

  Fly   411 DGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLR---------NTKHCT 466
            ..||.:..||:.||.|:.    ::.::|......:.|..|.|.|:.|::|         .:....
Human   299 FVGSAYFVLSQAFVKYIF----NNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPGEISRSAQDV 359

  Fly   467 SYVDNNLHVTNWKRKQGC---KCQYKHVVDWC--GCSPNDFKPED--WPRLQATEQKSLFFARKF 524
            |.:.:...:..|...:|.   .|...|:...|  |.:...:..:|  |            ||.||
Human   360 SDLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHW------------FANKF 412

  Fly   525 ----EPVINQAVLLQLEE----WLYGP 543
                :|::.:.:..:|||    |:..|
Human   413 DSKVDPILIKCLAEKLEEQQRDWITLP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 71/273 (26%)
Xylo_C 537..710 CDD:289306 4/11 (36%)
GCNT4NP_001353666.1 Branch 133..402 CDD:332239 71/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.