DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Wscd1

DIOPT Version :10

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001019405.1 Gene:Wscd1 / 287466 RGDID:1308212 Length:572 Species:Rattus norvegicus


Alignment Length:128 Identity:41/128 - (32%)
Similarity:63/128 - (49%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SSCPAGNHTANVSLGCFKDEKDRRLLAG--YYSSSKTSNSPAKCVELCLQSGYPYAGVQYGRECF 187
            :|.||.::..|. ||||.:|...|.|.|  :|...|.:.|  .|.|.|.:..|.|||::.|.||:
  Rat   131 ASGPASHNQGNY-LGCFSEEGQERTLKGAVFYDLRKMTVS--HCQEACAERSYVYAGLEAGAECY 192

  Fly   188 CGYDPPPKASKLPDSSCNTKCLGNAKEICGGFYAMNIYETGI------AKFTAQLAATTPSEE 244
            ||...|  |:::....||.:|.|....:||..:.:::|..|:      .::||......|..|
  Rat   193 CGNRLP--ATRVSLKECNQECKGEKGSMCGALHRLSVYSVGLQQSGAKKRWTATYRGCFPLPE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:460348 30/81 (37%)
Branch 250..504 CDD:452742
Xylo_C 537..709 CDD:463618
Wscd1NP_001019405.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..135 1/3 (33%)
WSC 139..231 CDD:214616 33/96 (34%)
WSC 242..337 CDD:214616 4/12 (33%)
Sulfotransfer_1 <422..551 CDD:473908
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.