DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Wscd1

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001019405.1 Gene:Wscd1 / 287466 RGDID:1308212 Length:572 Species:Rattus norvegicus


Alignment Length:128 Identity:41/128 - (32%)
Similarity:63/128 - (49%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SSCPAGNHTANVSLGCFKDEKDRRLLAG--YYSSSKTSNSPAKCVELCLQSGYPYAGVQYGRECF 187
            :|.||.::..|. ||||.:|...|.|.|  :|...|.:.|  .|.|.|.:..|.|||::.|.||:
  Rat   131 ASGPASHNQGNY-LGCFSEEGQERTLKGAVFYDLRKMTVS--HCQEACAERSYVYAGLEAGAECY 192

  Fly   188 CGYDPPPKASKLPDSSCNTKCLGNAKEICGGFYAMNIYETGI------AKFTAQLAATTPSEE 244
            ||...|  |:::....||.:|.|....:||..:.:::|..|:      .::||......|..|
  Rat   193 CGNRLP--ATRVSLKECNQECKGEKGSMCGALHRLSVYSVGLQQSGAKKRWTATYRGCFPLPE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068 30/81 (37%)
Branch 250..503 CDD:280621
Xylo_C 537..710 CDD:289306
Wscd1NP_001019405.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..135 1/3 (33%)
WSC 139..231 CDD:214616 33/96 (34%)
WSC 242..337 CDD:214616 4/12 (33%)
Sulfotransfer_1 <422..551 CDD:304426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10208
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.