DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Gcnt3

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_775434.1 Gene:Gcnt3 / 286976 RGDID:631333 Length:437 Species:Rattus norvegicus


Alignment Length:327 Identity:83/327 - (25%)
Similarity:145/327 - (44%) Gaps:43/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-LESKFPNIRL 305
            |:|.....||:.:.::.: :....|||:|:|.|:::|.:|||::....:::.:. :.|.|||:.:
  Rat   125 SKEEANFPIAYSMVIHEK-IENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSCFPNVFI 188

  Fly   306 ARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVK 370
            |.|..|.::...|.:...|.||||||||...|::::|...:|||:||..::|..|....|:|.::
  Rat   189 ANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSME 253

  Fly   371 GHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPA--GIQVDGGSDWVALSRPFVGYVTHPRED 433
            .......|..:.    |...|....::|....|.|.  .|.:..|:.::..||.|:.:|.    .
  Rat   254 SEVPPPHKTFRW----KYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVL----S 310

  Fly   434 DELLQALLKLFRHTLLPAESFFHTVLR----------NTKHCTSYVDNNLHVTNWKRKQG----- 483
            :...:.|::..:.|..|.|..:.|:.|          :.|...|.:.:...:|.|:..:|     
  Rat   311 NSKARQLIEWVKDTYSPDEHLWATLQRASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENG 375

  Fly   484 ---CKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWL----- 540
               ..|...|....|.....|        |....|.....|.||:|.::..||..|||:|     
  Rat   376 APYTSCSGIHQRAICVYGSGD--------LHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAI 432

  Fly   541 YG 542
            ||
  Rat   433 YG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 67/273 (25%)
Xylo_C 537..710 CDD:289306 5/11 (45%)
Gcnt3NP_775434.1 Branch 133..400 CDD:280621 68/283 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.