DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and gly-15

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_493164.2 Gene:gly-15 / 173114 WormBaseID:WBGene00001640 Length:420 Species:Caenorhabditis elegans


Alignment Length:258 Identity:55/258 - (21%)
Similarity:98/258 - (37%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLELESK-FPNIRL 305
            |:|.....:|:.:.::|..: |:..||.|:|.|::.:.:.||......:..|:.:.|: :.||:.
 Worm    97 SQEELEFPLAYGMLVHGDFV-QLSLLLSAIYQPQNQFCLAVDGNSSVEFIGLVRMLSRCYGNIQY 160

  Fly   306 ARKRFST---IWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRN 367
                |.|   .|.|..:||.:.||::.|.:....|.:...||..|.|:|:..:::..|.|..|  
 Worm   161 ----FITDEIRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNG-- 219

  Fly   368 FVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDW--------VALSRPFV 424
               ....|...|               ..:|: :||.|          |        .:||..|.
 Worm   220 ---SFNAEILPF---------------EFYRL-NRKRP----------WSSPLPLYKTSLSATFS 255

  Fly   425 GYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKH--------CTSYVDNNLHVTNWK 479
            ....:...:.|.:...:...|.|....||.:.|:..|.|.        ..:::..|...|..|
 Worm   256 RKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 53/250 (21%)
Xylo_C 537..710 CDD:289306
gly-15NP_493164.2 Branch 105..297 CDD:280621 50/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5479
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.820

Return to query results.
Submit another query.