DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and gly-18

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_492014.4 Gene:gly-18 / 172446 WormBaseID:WBGene00001643 Length:440 Species:Caenorhabditis elegans


Alignment Length:356 Identity:82/356 - (23%)
Similarity:132/356 - (37%) Gaps:84/356 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 YAMNIYETGIAKFTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDE 284
            |:.:..:|..:.|.......:|.||:..:....|:.   :.|.||..:|.::|.|::.|.|.|.|
 Worm    91 YSTDRCQTLKSLFRFNKVPLSPEEESFPLSYGLLVY---KELSQVLFMLSSIYHPQNEYCIAVGE 152

  Fly   285 RQDYLYRKLL-ELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDF 348
            ....:::.|| ||.:.|.||.. .||....||...::.....|:|.|......|.:...||..|.
 Worm   153 NSAPIFQNLLKELSNCFSNIHF-MKRPPIDWGSHEIINSAYDCLEFLSHLKSDWRYFQYLSGVDI 216

  Fly   349 PVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGG 413
            |:||..::|..|....|...|:....:.|:.   :|.::|              :.|..:.....
 Worm   217 PLKTNLEMVQILKHLNGTANVEIKPYQYQRL---RGKNET--------------QSPLPLFKSSL 264

  Fly   414 SDWVALSRPFVGYVTHPRE------DDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYVDNN 472
            |..:            |||      ...:.|.||:..|:|.:..|.|:.|:..| |:... :..:
 Worm   265 SSLI------------PREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGN-KNLFD-IPGS 315

  Fly   473 LHVTNWKRKQGCKCQYKHVVDWCGCSPND------------FKPE---------------DWPRL 510
            |:...|       ..||:.|:.....|.|            .||.               |.|||
 Worm   316 LNFKEW-------ISYKNNVETNLTYPTDGWRYYISRDQIWSKPNCHNYMKAGSCVFGIGDVPRL 373

  Fly   511 QATEQKSLF---FARKFEPVINQAVLLQLEE 538
              .:.|:|.   |..|.||   :|....|:|
 Worm   374 --LKSKALVAHKFYLKSEP---EAYFCLLKE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 61/271 (23%)
Xylo_C 537..710 CDD:289306 1/2 (50%)
gly-18NP_492014.4 Branch 136..373 CDD:280621 61/275 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.