DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and Gcnt1

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_006526742.1 Gene:Gcnt1 / 14537 MGIID:95676 Length:432 Species:Mus musculus


Alignment Length:314 Identity:80/314 - (25%)
Similarity:143/314 - (45%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-LESKFPNIRLARKRFSTI 313
            ||:.:.::.: :..:.|||:|:|.|::.|.||||.:.:..:...:: :.|.|.|:.:|.:..|.:
Mouse   127 IAYSIVVHHK-IEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVV 190

  Fly   314 WGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQK 378
            :...|.:...|.||:||.:.|.:|.::|||...|||:||..::|..|..:.|.|     ..||:|
Mouse   191 YASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGEN-----NLETEK 250

  Fly   379 F--IQKQGLDKTFVECDTHMWRIGDRKLPAGIQVD--GGSDWVALSRPFVGYVTHPREDDELLQA 439
            .  .:::...|.:...|..:...|..|.|..::..  .||.:..::|.:||||.    ::|.:|.
Mouse   251 MPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVL----ENENIQK 311

  Fly   440 LLKLFRHTLLPAESFFHTVLR----------NTKHCTSYVDNNLHVTNWKRKQG--------CKC 486
            |::..:.|..|.|..:.|:.|          :.|:..|.::.......|:..:|        ..|
Mouse   312 LMEWAQDTYSPDEFLWATIQRIPEVPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPC 376

  Fly   487 QYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWL 540
            ...||...|.....|.   .|    ...|..| ||.||:..::...:..|:|.|
Mouse   377 SGVHVRSVCVFGAGDL---SW----MLRQHHL-FANKFDMDVDPFAIQCLDEHL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 70/275 (25%)
Xylo_C 537..710 CDD:289306 2/4 (50%)
Gcnt1XP_006526742.1 Branch 127..395 CDD:396855 71/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.