DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and gcnt7

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_005168842.1 Gene:gcnt7 / 101886707 ZFINID:ZDB-GENE-120919-3 Length:436 Species:Danio rerio


Alignment Length:323 Identity:91/323 - (28%)
Similarity:154/323 - (47%) Gaps:46/323 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 TTP-SEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYR-KLLELESKFP 301
            |.| |:|.:...:||::|:: :.|....|||:|:|||::||.||:|::....|: .:..|...||
Zfish   100 TAPLSKEEEDYPLAFIITIH-KELATFVRLLRAIYAPQNVYCIHIDQKASEKYKSSVRNLSRCFP 163

  Fly   302 NIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSAN--P 364
            |:.|:.......:.|.|.|...:.||:||::|...|..||||...|:|::|..:||.::...  .
Zfish   164 NVFLSSVNVKVTYAGFSRLQADINCMKDLVESPIQWKKVINLCGQDYPIQTNLELVRYMQTPEWK 228

  Fly   365 GRNFVKG-------HGRETQKFIQKQGLDKTFVECDTHMWRIGDRK--LPAGIQVDGGSDWVALS 420
            .||...|       ..|...::::.:         :||:.:.|.:|  .|..:::..|:.:.:|:
Zfish   229 DRNMTPGIKQPPSMRYRTAFQYVEVK---------NTHVAQTGRKKGPPPHNLKIYFGTAYYSLT 284

  Fly   421 RPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYV----DNNLHVTNWKRK 481
            ||||.||.    |:.:.:.||...:.:..|.|.::.|:....:...|.|    :.|:....|..:
Zfish   285 RPFVEYVL----DNPVAKDLLSWSKDSYSPDEHYWVTLNHIKEAPGSNVEGEWEGNVRAVKWSDQ 345

  Fly   482 -----QGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEW 539
                 ||||.||...:...|..       |.|.|  .|::|: ||.|||.......|..:|.|
Zfish   346 QGTAHQGCKGQYIRGICVYGIG-------DLPWL--IEKESM-FANKFEMASFPEALDCMELW 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068
Branch 250..503 CDD:280621 74/273 (27%)
Xylo_C 537..710 CDD:289306 2/3 (67%)
gcnt7XP_005168842.1 Branch 112..373 CDD:280621 77/283 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0799
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.