DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and kremen1

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001108389.1 Gene:kremen1 / 100141352 ZFINID:ZDB-GENE-070705-262 Length:465 Species:Danio rerio


Alignment Length:106 Identity:34/106 - (32%)
Similarity:53/106 - (50%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SLGCFKDEKDRRLLAGYYSSSKTSNSPAKCVELCLQSGYPYAGVQYGRECFCGYDPP-PKASKLP 200
            :||||||..|...|:|.:.:| |..:...|:..|....|..||::.|..||||.|.. .:....|
Zfish   114 NLGCFKDSGDPTPLSGSHQTS-TKLTIQNCISFCRNQRYKLAGMESGYACFCGDDREYHRHGDAP 177

  Fly   201 DSSCNTKCLGNAKEICGGFYAMNIYETGI----AKFTAQLA 237
            ::.||..|.|:..:.|||...:.:::|.:    ..||:..|
Zfish   178 NTECNHVCFGDHTQPCGGDGRIIVFDTKVGACGGNFTSPSA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068 28/80 (35%)
Branch 250..503 CDD:280621
Xylo_C 537..710 CDD:289306
kremen1NP_001108389.1 KR 26..109 CDD:238056
WSC 114..195 CDD:280068 28/81 (35%)
CUB 209..315 CDD:238001 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.