DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oxt and wscd2

DIOPT Version :9

Sequence 1:NP_647705.1 Gene:oxt / 38288 FlyBaseID:FBgn0015360 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001106553.1 Gene:wscd2 / 100127745 XenbaseID:XB-GENE-6039192 Length:230 Species:Xenopus tropicalis


Alignment Length:258 Identity:62/258 - (24%)
Similarity:97/258 - (37%) Gaps:71/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RWLKR--YRAF-FLILLLIVAIQLFL--AYKSLDIVG-------GGSGSGFDAAE---APAS--- 54
            |:.:|  .|.| |:||.|.....:||  :::...||.       .|:.:|.|..|   ||.|   
 Frog    10 RYFRRKPVRFFTFIILYLTAGSVVFLHASFEGEQIVSDNDKTSVDGTSNGPDVQELGIAPLSRVF 74

  Fly    55 ---PPPPHAQARVQP---------PARTKLTAQQLGFQPECDILAREAISALQRAKTKDCREHIA 107
               |..|....|..|         |.|.|        |.|.......|:......:.::||... 
 Frog    75 KEVPESPSTHRRYGPWLKTPGKELPERIK--------QGEFGGTWNRALKGRSMREQEECRAKY- 130

  Fly   108 QIACAIQAGRFYAPQLRSSCPAGNHTANVSLGCFKDEKDRRLLAGYYSSSKTSNSPAKCVELCLQ 172
                                          :||:.|:..:|.|.|.........:..:|.:.|.:
 Frog   131 ------------------------------IGCYTDDTRQRALRGVSFFDYKKMTVFRCQDNCAE 165

  Fly   173 SGYPYAGVQYGRECFCGYDPPPKASKLPDSSCNTKCLGNAKEICGGFYAMNIYETGIAKFTAQ 235
            .||.|||:::|.||:||:  ..||..:.:|.||.:|.|.....|||...::||...:.:.:|:
 Frog   166 RGYMYAGLEFGAECYCGH--RIKALNVSESECNMECKGEKGNFCGGVNRLSIYRLELNQESAR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oxtNP_647705.1 WSC 138..218 CDD:280068 26/79 (33%)
Branch 250..503 CDD:280621
Xylo_C 537..710 CDD:289306
wscd2NP_001106553.1 WSC 127..219 CDD:214616 31/124 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9958
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.