DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2034 and IKI1

DIOPT Version :9

Sequence 1:NP_001261322.1 Gene:CG2034 / 38287 FlyBaseID:FBgn0015359 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_012057.3 Gene:IKI1 / 856594 SGDID:S000001230 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:62/275 - (22%)
Similarity:101/275 - (36%) Gaps:92/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGVSLKH---VATFEALIDKYANNNTG 71
            :|.:::||.||  .|:.::|...|.|              ::..|   |||:...|         
Yeast   100 KKHMVIIDSLN--YISTEYITRFLSE--------------IASPHCTMVATYHKDI--------- 139

  Fly    72 STTDSNST---GFNVILPTLADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQDPHADYI 133
              .|.|.|   .:|...|....||.:.....:                            ..|.:
Yeast   140 --KDENRTVIPDWNNNYPDKLTLLQFMATTIV----------------------------DIDVV 174

  Fly   134 LAG---CEYLAELVLR------LESDKL-LSLISRKPGGG-------VSNRRYSCE-VSKTQFKV 180
            |.|   .|.::||:..      |.:|.. |.|::::..|.       |::..:..| :|.|:.:.
Yeast   175 LTGTLDTEEVSELLNEFRIPRGLNNDIFQLRLVNKRKSGRSLEYDFIVNSNTHEYELLSTTKQEE 239

  Fly   181 TPLDGGLPAGASPKQPSPEAEQTTEPASSTFKIELDEDEVLARNALTLPY-ERTSEPSEGNIIYT 244
            .....||        .:||..|    ..:||.:.....:.||::.:.||: |..|....|.|:|.
Yeast   240 ESSSNGL--------ETPEMLQ----GLTTFNLGTSNKQKLAKDQVALPFLEAQSFGQGGAIVYE 292

  Fly   245 PDADDDFDEEDPDED 259
            .:.|||:|||||.||
Yeast   293 YEKDDDYDEEDPYED 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2034NP_001261322.1 None
IKI1NP_012057.3 Elong_Iki1 11..290 CDD:402212 50/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15641
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.