DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2034 and Elp5

DIOPT Version :9

Sequence 1:NP_001261322.1 Gene:CG2034 / 38287 FlyBaseID:FBgn0015359 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_061210.2 Gene:Elp5 / 54351 MGIID:1859017 Length:300 Species:Mus musculus


Alignment Length:253 Identity:69/253 - (27%)
Similarity:102/253 - (40%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KALPTGVSLKHVATFEALIDKYANNNTGSTTDSNSTGFNVILPTLADLLCYQTPAFIFGFLNRLR 108
            :|:|.|       ..:||.......:.||.|        :.|.:|:.|||:.....:...|:.|.
Mouse    81 EAVPEG-------PLKALRSMCKRTDHGSVT--------IALDSLSWLLCHIPCVTLCQALHALS 130

  Fly   109 R-----SDN--VRRV-FLWASPQHLQDP----------HADYILAGCEYLAELVLRLESDKLLSL 155
            :     .||  |.:| .|....:.|..|          |.:..|:|         :::... .|:
Mouse   131 QQNGDPGDNSLVEQVRVLGLLHEELHGPGSMGALNTLAHTEVTLSG---------KVDQTS-ASI 185

  Fly   156 ISRKPGGGVSNRRYSCEVSKTQFKVTP-----LDGGLPAGASPKQPSPEAEQTTEPASSTFKIEL 215
            :.|:|....:.:.:       .|.|.|     |..|||. .|...|.....|....|..||.:.|
Mouse   186 LCRRPQQRATYQTW-------WFSVLPDFSLTLHEGLPL-RSELHPDHHTTQVDPTAHLTFNLHL 242

  Fly   216 DEDEVLARNALTLPYERTSE---------PSE--GNIIYTPDADDDFDEEDPDEDLCI 262
            .:.|..||::||||::.:||         ||.  |:|.|.|||.||.|.||||:||.|
Mouse   243 SKKEREARDSLTLPFQFSSEKQKALLHPVPSRTTGHIFYEPDAFDDVDPEDPDDDLDI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2034NP_001261322.1 None
Elp5NP_061210.2 Elong_Iki1 11..282 CDD:371082 55/233 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..300 14/20 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15641
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.060

Return to query results.
Submit another query.