DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2034 and Elp5

DIOPT Version :9

Sequence 1:NP_001261322.1 Gene:CG2034 / 38287 FlyBaseID:FBgn0015359 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017452581.1 Gene:Elp5 / 287446 RGDID:1303303 Length:320 Species:Rattus norvegicus


Alignment Length:335 Identity:78/335 - (23%)
Similarity:122/335 - (36%) Gaps:111/335 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DELNRERIAPKFIGSLLHEQG----------QGADTIKALPTGVSLK----HVATFEALIDKYAN 67
            |::.|...|.:.:.|||...|          :|...:|||....:|:    ||...|...:::  
  Rat     8 DDIRRRPEASEMLDSLLATGGLVLLRDSVEWEGRGLLKALIKKSALRGEQVHVLGCEVSEEEF-- 70

  Fly    68 NNTGSTTDSNST--------------------------------------GFNVILPTLADLLCY 94
             ..|..:|.||.                                      ...:.|.:|:.|||:
  Rat    71 -REGLGSDVNSRLVYHDLFRDPLNWSQPGEAAPEGPLKALRSMCRRTDRGSVTIALDSLSWLLCH 134

  Fly    95 QTPAFIFGFLNRLRR-------SDN-----VRRVFLWASPQHLQDP--------HADYILAGCEY 139
            .....:...|:.|.:       .||     ||.:.|.....|...|        |.:..|:|   
  Rat   135 IPCVTLCQALHALSQRNVDPGAGDNPLIEQVRVLGLLHEELHGPGPVGAVSSLAHTEVTLSG--- 196

  Fly   140 LAELVLRLESDKLLSLISRKPGGGVSNRRYSCEVSKTQFKVTP-----LDGGLPAGASPKQPSPE 199
                  :::... .|::.|:|....:.:.:       .|.:.|     |..|||. .|.....|.
  Rat   197 ------KMDQTS-ASILCRRPQQRATYQTW-------WFSILPDFSLDLHEGLPL-HSELHRDPH 246

  Fly   200 AEQTTEPASS-TFKIELDEDEVLARNALTLPYERTSEPSE-----------GNIIYTPDADDDFD 252
            ..| .:|||. ||.:.|.:.|..|:::||||::.:||..:           |.|.|.|||.||.|
  Rat   247 TTQ-VDPASHLTFNLHLSKKEREAKDSLTLPFQFSSEKQQALLHPVPGQTTGRIFYEPDAFDDVD 310

  Fly   253 EEDPDEDLCI 262
            :||||:||.|
  Rat   311 QEDPDDDLDI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2034NP_001261322.1 None
Elp5XP_017452581.1 Elong_Iki1 19..302 CDD:287458 61/304 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15641
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7389
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
55.060

Return to query results.
Submit another query.