DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2034 and iki1

DIOPT Version :9

Sequence 1:NP_001261322.1 Gene:CG2034 / 38287 FlyBaseID:FBgn0015359 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_595851.1 Gene:iki1 / 2540822 PomBaseID:SPBC18E5.05c Length:314 Species:Schizosaccharomyces pombe


Alignment Length:306 Identity:71/306 - (23%)
Similarity:114/306 - (37%) Gaps:92/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLVIDELNRERIAPKFIGSLLHEQG-QGADTIKALPTGVS------LKHVATFEALIDKYANNNT 70
            ||.|.....|:.||:.|...|:... :...::|.|...:|      .:|:...:.:      |..
pombe    45 VLFISYETLEKEAPEGIDCFLYATSWEKVKSLKELYEHISSWRTQGKQHIVMIDTI------NPI 103

  Fly    71 GSTTDSNSTGFNVILPTLADLLCYQTPAFIFGFLNRLRRSDNVRRVFLWASPQHLQ--DPHADYI 133
            .:|:.|:.|.|      ...:|...:..|:..|         .:.|.|...|.:|.  :...|:.
pombe   104 LNTSISSFTMF------FGSVLALGSICFLTSF---------HKDVTLENYPSYLPPCEVFLDFT 153

  Fly   134 ------LAGCEYLA------------ELVLRLESDKLLSLIS-------------RKPGGGVSNR 167
                  |.|.::|:            .|:..|:.||::||:.             ||..|.:.  
pombe   154 STCTVSLIGMQHLSVEHDAKMRSLPNPLLEELQDDKIISLLGSNCETAIVLHVEFRKKSGRII-- 216

  Fly   168 RYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEAEQTTEPASS------TFKIELDEDEVLARNAL 226
            :.||.:...:.:             |..|..|..:..|||.:      :|.:.:.|.|...|:.:
pombe   217 KESCVLKNGKLE-------------PYTPFEETARGPEPADNQIDFNVSFNLNVSEKERKERDKV 268

  Fly   227 TLPY---------ERTSEPSEGNIIYTPDADDDFD-EEDPDEDLCI 262
            .|||         .::|...||.|||..|..|||| |||.||||.|
pombe   269 FLPYFSAQMVGSQHKSSFVDEGTIIYHADEADDFDEEEDADEDLLI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2034NP_001261322.1 None
iki1NP_595851.1 Elong_Iki1 5..295 CDD:287458 57/285 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15641
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.