DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1275 and F39G3.4

DIOPT Version :10

Sequence 1:NP_647703.1 Gene:CG1275 / 38286 FlyBaseID:FBgn0035321 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_504270.2 Gene:F39G3.4 / 185502 WormBaseID:WBGene00018209 Length:244 Species:Caenorhabditis elegans


Alignment Length:147 Identity:32/147 - (21%)
Similarity:50/147 - (34%) Gaps:60/147 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SIVHLLYGFYIFSSAVAGDISQTLNDY------------LFKSNVAFGETGQ-------NQTNVE 64
            :|...|||       ||..|.::|..|            :...|:::|..|:       :|..|:
 Worm    32 TIASSLYG-------VALQIRRSLYRYSLLQKHRLPVPVISVGNLSWGGNGKTPMVEYISQFLVD 89

  Fly    65 -GLPPIVLVHGIFGFGKGRLGGLSYFGGAEKKDERVLVPDLGSLTSIYDRARELFYYLKGGVVDF 128
             ||.|::|..|             |.||                    |..:.|..:|:||.|..
 Worm    90 SGLTPLILTRG-------------YAGG--------------------DEVKMLERHLRGGPVKI 121

  Fly   129 GEEHSEACGHSRFGRRY 145
            |...:.|...:.|..:|
 Worm   122 GVGANRAATAALFLDKY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1275NP_647703.1 rne <5..103 CDD:236766 22/103 (21%)
Cyt_b561_CG1275_like 120..336 CDD:176494 8/26 (31%)
F39G3.4NP_504270.2 Cytochrom_B561 60..189 CDD:427188 23/112 (21%)

Return to query results.
Submit another query.