Sequence 1: | NP_728724.2 | Gene: | CG32301 / 38285 | FlyBaseID: | FBgn0052301 | Length: | 1111 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598582.3 | Gene: | Phlpp1 / 98432 | MGIID: | 2138327 | Length: | 1687 | Species: | Mus musculus |
Alignment Length: | 294 | Identity: | 56/294 - (19%) |
---|---|---|---|
Similarity: | 107/294 - (36%) | Gaps: | 97/294 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 LEADMVDFTGLTTTMEVSD------------LVAILH---ELFVSFD--------LAANHNRATR 335
Fly 336 ---------IKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISR----EVSKRRNKKIDLRIG 387
Fly 388 VHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGTDTAKL 452
Fly 453 DP-LLQRSNLSTYLIRS-----RLPN---FEDTDDLEDDNFSLNDYRFSFSFSQDYEDIQVKAQR 508
Fly 509 DMILEVEHMPVNRVQTCKIRRPMHRIAK-EDINE 541 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32301 | NP_728724.2 | Nucleotidyl_cyc_III | 283..439 | CDD:299850 | 32/180 (18%) |
CYCc | 812..1051 | CDD:214485 | |||
Nucleotidyl_cyc_III | 841..1076 | CDD:299850 | |||
Phlpp1 | NP_598582.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..96 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 230..406 | ||||
PH_PHLPP-like | 491..587 | CDD:270131 | |||
PH | 511..592 | CDD:278594 | |||
LRR_RI | 581..885 | CDD:238064 | 20/112 (18%) | ||
LRR_8 | 594..659 | CDD:290566 | |||
LRR 1 | 594..615 | ||||
leucine-rich repeat | 597..617 | CDD:275380 | |||
LRR 2 | 617..638 | ||||
leucine-rich repeat | 618..648 | CDD:275380 | |||
LRR_8 | 647..726 | CDD:290566 | |||
LRR 3 | 648..669 | ||||
LRR 4 | 671..692 | ||||
leucine-rich repeat | 672..694 | CDD:275380 | |||
LRR 5 | 694..715 | ||||
leucine-rich repeat | 695..717 | CDD:275380 | |||
LRR 6 | 717..739 | ||||
leucine-rich repeat | 718..740 | CDD:275380 | |||
LRR 7 | 740..760 | ||||
leucine-rich repeat | 741..764 | CDD:275380 | |||
LRR 8 | 764..785 | 4/6 (67%) | |||
LRR_RI | 768..1030 | CDD:238064 | 56/294 (19%) | ||
leucine-rich repeat | 768..788 | CDD:275380 | 6/9 (67%) | ||
LRR 9 | 788..809 | 2/20 (10%) | |||
leucine-rich repeat | 789..809 | CDD:275380 | 2/19 (11%) | ||
leucine-rich repeat | 810..851 | CDD:275380 | 6/40 (15%) | ||
LRR 10 | 829..850 | 3/20 (15%) | |||
LRR 11 | 851..872 | 4/26 (15%) | |||
leucine-rich repeat | 852..874 | CDD:275380 | 4/27 (15%) | ||
LRR 12 | 874..895 | 4/20 (20%) | |||
leucine-rich repeat | 875..897 | CDD:275380 | 4/21 (19%) | ||
LRR_8 | 896..954 | CDD:290566 | 17/90 (19%) | ||
LRR 13 | 897..918 | 9/37 (24%) | |||
leucine-rich repeat | 898..919 | CDD:275380 | 9/48 (19%) | ||
LRR 14 | 919..940 | 6/25 (24%) | |||
leucine-rich repeat | 920..943 | CDD:275380 | 6/27 (22%) | ||
LRR 15 | 943..964 | 4/20 (20%) | |||
leucine-rich repeat | 944..967 | CDD:275380 | 5/22 (23%) | ||
LRR 16 | 969..989 | 1/24 (4%) | |||
LRR_8 | 970..1028 | CDD:290566 | 13/63 (21%) | ||
leucine-rich repeat | 970..993 | CDD:275380 | 1/27 (4%) | ||
LRR 17 | 993..1014 | 8/27 (30%) | |||
leucine-rich repeat | 994..1017 | CDD:275380 | 9/26 (35%) | ||
LRR 18 | 1017..1038 | 1/4 (25%) | |||
LRR 19 | 1040..1061 | ||||
LRR 20 | 1062..1083 | ||||
leucine-rich repeat | 1063..1085 | CDD:275380 | |||
LRR 21 | 1085..1106 | ||||
PP2Cc | 1124..1376 | CDD:214625 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1414..1465 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1604..1687 | ||||
PDZ-binding | 1685..1687 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |