DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy2d

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_077356.1 Gene:Gucy2d / 79222 RGDID:620438 Length:1108 Species:Rattus norvegicus


Alignment Length:280 Identity:79/280 - (28%)
Similarity:117/280 - (41%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 EKKHELTKVKTRTIKIIMANILPTHVAEVFKVRRRSDQLYYEN----FSQVAVMFATIENYEADK 863
            |:..||.:.|.:|.: ::..:||..|||..|:....:..|:|.    ||.: |.|.||.......
  Rat   840 ERTEELEQEKQKTDR-LLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDI-VGFTTISAMSEPI 902

  Fly   864 SGLRALHEMICYFDELLVNYQSWYKIEKIKVMGWTYLAACGLHVDHYTDFSVSVPISTNRESDKL 928
            ..:..|:::...||.::.::.. ||:|.|   |..|:.|.||...:....:..:   .|...|.|
  Rat   903 EVVDLLNDLYTLFDAIIGSHDV-YKVETI---GDAYMVASGLPQRNGQRHAAEI---ANMSLDIL 960

  Fly   929 QKSGSVRFAPMDGDEIMIKDLHPTQATTNEDDNTILVMTEFALNLLRILRDIRSKGIFFEKDSKL 993
            ...||.|...|  .|:.::                                              
  Rat   961 SAVGSFRMRHM--PEVPVR---------------------------------------------- 977

  Fly   994 TGSLKIGIAHGPVMAGVVGLSKPHYDIWGHTVNMASRMTSTGVRDGIHVTESTANVLR----DFN 1054
               ::||:..||.:||||||:.|.|.::|.|||.||||.|||:...|||..||..:||    .|.
  Rat   978 ---IRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQ 1039

  Fly  1055 IRCTYRGMTFVKGVGQVPTY 1074
            :.|  ||.|.:||.|...||
  Rat  1040 MEC--RGRTELKGKGVEDTY 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850
CYCc 812..1051 CDD:214485 64/242 (26%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 68/242 (28%)
Gucy2dNP_077356.1 PBP1_sensory_GC_DEF-like 58..434 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 520..552
PK_GC-2D 540..814 CDD:270945
HNOBA <823..868 CDD:400168 10/28 (36%)
CYCc 848..1039 CDD:214485 66/250 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1069..1108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.