DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy2g

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:263 Identity:64/263 - (24%)
Similarity:133/263 - (50%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ALLDSIIP--VTLARSLQDAIASH----------IEEDPSNLMPFTKTRHLF----MEP-HPE-V 291
            ::|||::.  .|.|..|::.:...          :|:..|.::|......|.    :|| |.| |
Mouse   836 SILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESV 900

  Fly   292 SILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIP-SYFPT 355
            :|..:|:|.||.|.:......:|.:|::|:..||.....:...:::.:||:|...:|:| .....
Mouse   901 TIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQ 965

  Fly   356 HANACVNQALDMIEISR--EVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRL 418
            ||:.....||.::.::.  ::.....:::.||||:|:|.::||::|:|..::.::...|::.:|:
Mouse   966 HADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRM 1030

  Fly   419 ESSGLPGMVHISSRTLGLL---DNHYVYEEGTDTAKLDPLLQRSNLSTYLIRSR------LPNFE 474
            |||.||..:|:|..|.|.|   ..:::.:.||.:.|     .:...:|:.::.:      ||.|.
Mouse  1031 ESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVK-----GKGEQTTFWLKGKDGFPVPLPEFT 1090

  Fly   475 DTD 477
            :.:
Mouse  1091 EEE 1093

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 48/167 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 51/189 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.