DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and npr3

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:380 Identity:72/380 - (18%)
Similarity:133/380 - (35%) Gaps:120/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NIDFLTVLPYFAVMLLTPSILMPS--------REP--------NVEQYESIAILVSCLMALLLTA 123
            ||:.:.:||.....|.:.:.:.|:        ||.        || ::|:.|..:..|.||:...
Zfish    27 NIEVMVMLPRNNTYLFSYTRVFPAIEYAKKALREADAYAGLRFNV-RFENSACGMDALYALVDRQ 90

  Fly   124 M----DLIL-PICYFRPFSLVPSYDHVVIVLIYLMFPIAFVKNGRAYFLGLAVSLFYFGYMALID 183
            .    ||:| |:|.:...|:.....|..|.:|                   :......|:.:...
Zfish    91 KDERPDLVLGPVCEYAASSVTRVASHWNIPVI-------------------SAGALATGFNSKTP 136

  Fly   184 KISTLDKVWELTAYGAYLFFLNMLCMFLSRFQEYNMRSGILSRYQVVYQNLVFQMAMKEEKALLD 248
            :.|.|.::...        :|.|...|.:.|..:..|:..|     :|.:      .|:|:....
Zfish   137 EYSHLTRIAPT--------YLKMAETFQAIFGHFGWRTAYL-----IYDD------DKDERNCYF 182

  Fly   249 SIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEA--DMVDFTGLTTTMEVS 311
            ::..|....|     ..||..|                    .::|.:  :.||..|:.|::..|
Zfish   183 TMEGVFTVLS-----EYHISTD--------------------FAVLNSNEERVDPDGIITSVYGS 222

  Fly   312 DLVAILHELFVSFDL-AANHNRATRIKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVS 375
            ::|.:..:..:..|| .|.|.|    |...||:.       :|             .||:....|
Zfish   223 EVVIMCSKADIVRDLMLAAHRR----KLTSDSHI-------FF-------------NIELFNSSS 263

  Fly   376 ------KRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLP 424
                  :||:|..|.....:|......::..||.:|:.:|  :::...|:.|.:|
Zfish   264 YGDGSWRRRDKYDDEARAAYSFLNTVTLLRSTKPEFEDFS--IEMKKSLQQSNIP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 31/151 (21%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 70/378 (19%)
ANF_receptor 46..389 CDD:279440 67/361 (19%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.