DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gucy2cb

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_021329920.1 Gene:gucy2cb / 568219 ZFINID:ZDB-GENE-130531-31 Length:1071 Species:Danio rerio


Alignment Length:351 Identity:81/351 - (23%)
Similarity:159/351 - (45%) Gaps:74/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 QEY-NMRSGILSRYQVVYQNLVFQMAMKEEKALLDS-----------IIPVTLARSLQDAIASHI 267
            ||: :....::.|.|:..:||  :..::|..||..:           ::|..:.|||::      
Zfish   745 QEHESYMENLIRRLQMYSRNL--ERLVEERTALYKAERDRADCLNFMLLPGPVVRSLKE------ 801

  Fly   268 EEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGL---TTTMEVSDLVAILHELFVSFDLAAN 329
                        |..:..|...||:|..:|:|.||.|   :|.|||.|:   |::::.:||...:
Zfish   802 ------------TGKVEPELFDEVTIYFSDIVGFTTLCHFSTPMEVVDM---LNDIYKNFDSILD 851

  Fly   330 HNRATRIKFLGDSYTCVTGIPSYFPT-HANACVNQALDMIEI--SREVSKRRNKKIDLRIGVHSG 391
            ::...:::.:||:|..|:|:|..... ||......|||::..  :.::|......:.:|||||||
Zfish   852 NHDVYKVETIGDAYMVVSGLPRRNGNRHAKDICLMALDILAFMGTIQLSHLPGIPVWIRIGVHSG 916

  Fly   392 EILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLL---DNHYVYEEGTDTAKLD 453
            ...||::|:...::.::...|:..:|:||:|||..:|:|..|:.:|   |..:.|||..:|.   
Zfish   917 PCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSQSTINILQRTDCKFEYEERGETF--- 978

  Fly   454 PLLQRSNLSTYLIRSRLPNFEDTDDLEDDNFSLNDYRFSFSFSQDYEDIQVKAQRDMILEVEHMP 518
             |..:....||.:..          :..:|::|.....:.:|....:|:.               
Zfish   979 -LKGKGKEMTYWLTG----------VTGENYNLPTPPTAENFQNLQQDLS--------------- 1017

  Fly   519 VNRVQTCKIRRPMHRIAKEDINEEYR 544
             ..::||..:||.....::.::..:|
Zfish  1018 -EMIKTCLQKRPSGLWRRKTLSARHR 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 50/164 (30%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gucy2cbXP_021329920.1 Periplasmic_Binding_Protein_Type_1 33..408 CDD:324556
PKc_like 471..741 CDD:328722
CYCc 778..970 CDD:214485 56/212 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.