DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and npr1a

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001038402.1 Gene:npr1a / 560653 ZFINID:ZDB-GENE-060503-539 Length:1067 Species:Danio rerio


Alignment Length:253 Identity:64/253 - (25%)
Similarity:123/253 - (48%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 YGAYLFFLNMLCMFLSRFQEY--NMRSGILSRYQVVYQNLVFQMAMKEEKALLDSIIPVTLARSL 259
            ||:     |:|...|||.::|  |:...:..|.|..::.      .::.:|||..|:|.::|..|
Zfish   815 YGS-----NILDNLLSRMEQYANNLEELVEERTQAYHEE------KRKAEALLYQILPHSVAEQL 868

  Fly   260 QDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSF 324
            :                  :...:..|....|:|..:|:|.||.|:......::|.:|::|:..|
Zfish   869 K------------------RGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLLNDLYTCF 915

  Fly   325 DLAANHNRATRIKFLGDSYTCVTGIP-SYFPTHANACVNQALDMIEI--SREVSKRRNKKIDLRI 386
            |...::....:::.:||:|..|:|:| .....||......:|.::|.  |..:..|.|.::.|||
Zfish   916 DAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRI 980

  Fly   387 GVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYE 444
            |:|||.:.||::||...::.::...|:..:|:||:|....:|:|..|..:|.....::
Zfish   981 GIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQ 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 46/158 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
npr1aNP_001038402.1 PBP1_NPR_A 48..449 CDD:107380
ANF_receptor 66..421 CDD:279440
PK_GC-A_B 540..814 CDD:270944
TyrKc 554..808 CDD:197581
HNOBA <823..868 CDD:285003 13/50 (26%)
CYCc 847..1032 CDD:214485 52/208 (25%)
Guanylate_cyc 874..1060 CDD:278633 46/165 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.