DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and ADCY10

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:577 Identity:107/577 - (18%)
Similarity:194/577 - (33%) Gaps:227/577 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 QEYNMRS-----------GILSRYQ---VVYQNLVFQMAMKEEKALLDSIIPVTLARSLQDAIAS 265
            |:|.|.|           |.||..:   :|:.||:|:...|.|:          :..::|||. .
Human   266 QKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLMFEDQDKAEE----------IGPAIQDAY-M 319

  Fly   266 HIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANH 330
            ||                       .|:|:.    |.|.            ::::|: ||     
Human   320 HI-----------------------TSVLKI----FQGQ------------INKVFM-FD----- 339

  Fly   331 NRATRIKFLGDSYTCVTGIP-SYFP---THANACVNQALDMIEISREVSKRRNKKIDLRIGVHSG 391
                    .|.|:.||.|.| ...|   |||..|   |:|:.:...:|.|.:.    :.|||.||
Human   340 --------KGCSFLCVFGFPGEKVPDELTHALEC---AMDIFDFCSQVHKIQT----VSIGVASG 389

  Fly   392 EILAGIIGLT-KWQFDIWSKDVDITNRLESSGLPGMVHISSRTL-------------------GL 436
            .:..||:|.| :.::.:..:.|::..|: ....||:|...|.|.                   |:
Human   390 IVFCGIVGHTVRHEYTVIGQKVNLAARM-MMYYPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGV 453

  Fly   437 LDNHYVYEEGTDTAKL--------------DPLLQRSNLSTYLIRSRLPNFEDTDDLEDDNFSLN 487
            .|:..:|:....|.|:              .|||.|:....|                   |...
Human   454 ADSGPLYQYWGRTEKVMFGMACLICNRKEDYPLLGRNKEINY-------------------FMYT 499

  Fly   488 DYRFSFSFSQD---YEDIQVKAQRDMILEVEHMPVNRVQTCKIRRPMHRIAKEDINEEYRFHLES 549
            ..:|..|.|..   ||.:....:..:::::|::...:         .|||....:| :..|| ::
Human   500 MKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGK---------NHRIIAISLN-KISFH-QT 553

  Fly   550 YYLFTTFRSWRMEWSFNKMRDLLMKYSLGMMVFAGATIIAMDLL---------VKSEAMDYTMLF 605
            :|....|.                           |.::.:|..         ::::.|  |:|.
Human   554 FYTIQMFM---------------------------ANVLGLDTCKHYKERQTNLRNKVM--TLLD 589

  Fly   606 SLFLLILLPLLLASYKKLWLRGRRLSPITQPTFFLSRWFIKASDLIEKSVFVRIPLAIMVLFLLY 670
            ..|..:                  |:.|....|.:||...:.|.|.::.   ::.:..|.:..|.
Human   590 EKFYCL------------------LNDIFHVQFPISREISRMSTLKKQK---QLEILFMKILKLI 633

  Fly   671 VMSSETVFSCDIARLELEIINSELHNLRPQMLCFMPWGVTYAVVIVLSLMLVIIGIP 727
            |.....:|..|    |.:.::|.......:::..:|      :.|::|| ...:.||
Human   634 VKEERIIFIID----EAQFVDSTSWRFMEKLIRTLP------IFIIMSL-CPFVNIP 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 39/179 (22%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
ADCY10NP_060887.2 CHD 40..214 CDD:143636
AcyC <42..197 CDD:225025
CHD 292..461 CDD:143636 51/240 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.