DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and gucy1b2

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:326 Identity:82/326 - (25%)
Similarity:149/326 - (45%) Gaps:57/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 ILSRYQVVYQNLVFQMAMKEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEP 287
            ||||      ||..: ..|.|| ||.:::|..:|..|::  ...:|.....:             
Zfish   425 ILSR------NLEIE-KQKSEK-LLYAMLPTHVANQLKE--GKRVEAGEFKV------------- 466

  Fly   288 HPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGIPSY 352
               .:||.:|:|.||.:....|...:|.:|:.::..||...:.:...:::.:||:|..|.|:|..
Zfish   467 ---CTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVP 528

  Fly   353 FPTHANACVNQALDMIEISREVSKR-RNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITN 416
            ..|||....|.||.|...:|||:.. ..:.|.:|:|:|:|.:|||::|....::.::...|:..:
Zfish   529 TNTHAERVANFALGMRIAAREVTNPITGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTAS 593

  Fly   417 RLESSGLPGMVHISSRTLGLLDNHYVY---EEGTDTAKLDPLLQRSNLSTYLIRSRLPNFEDTDD 478
            |:||.|:|..:|:|..|..::.:..::   |.|....|...|::     ||.:   |.|.:.:|:
Zfish   594 RMESHGVPDHIHVSPFTFSVIKDKGIFEMAERGEIEVKGKGLMR-----TYFL---LKNLQKSDE 650

  Fly   479 ----LEDDNFSLNDYRFSFSFSQDYEDIQVKAQRDMILEVEHMPVNRVQTCKIRRPMHRIAKEDI 539
                |.|....:        :.:|.|:     :.|.:.||....:|.|  .|:....|:...|:.
Zfish   651 QIMGLVDGEMCV--------YQEDLEE-----ETDDLKEVSPEDMNAV--LKVEEDAHKEVAENG 700

  Fly   540 N 540
            |
Zfish   701 N 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 45/156 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454
HNOBA 269..453 CDD:285003 13/35 (37%)
CYCc 432..618 CDD:214485 54/205 (26%)
Guanylate_cyc 459..642 CDD:278633 52/206 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.