DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gucy1b1

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:358 Identity:82/358 - (22%)
Similarity:162/358 - (45%) Gaps:81/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GRAYFLGLAVSLFYFGYMALIDKISTLDKVWELTAYGAYLFFLNM------LCMFLSRF-QEYNM 219
            |:..:|..|.|:.:.    ....:..||   :||..|.||..:.:      |.:...:| :||.:
Mouse   308 GQMIYLPEADSILFL----CSPSVMNLD---DLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKL 365

  Fly   220 RSGILSRYQVVYQNLVFQM-AMKEEK----ALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTK 279
            ...:    :::...|...: |:::||    .||.|::|.::|..|:     |....|:       
Mouse   366 TQEL----EILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELR-----HKRPVPA------- 414

  Fly   280 TRHLFMEPHPEVSILEADMVDFTGLTTTMEVSD----LVAILHELFVSFDLAANHNR---ATRIK 337
                  :.:..|:||.:.:|.|....:.....:    :|.:|::|:..||...:..:   ..:::
Mouse   415 ------KRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVE 473

  Fly   338 FLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVSKRRNKKIDLRIGVHSGEILAGIIGLTK 402
            .:||.|..|:|:|.....||.:..:.||||:||:.:| :...:.:.:.||:|:||::.|:||...
Mouse   474 TVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQV-QVDGESVQITIGIHTGEVVTGVIGQRM 537

  Fly   403 WQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLLDNHYVYEEGTD-------------TAKLDP 454
            .::.::...|::|:|.|::|..|.:::|..|...|    :..|.:|             ..|.:|
Mouse   538 PRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCL----MSPENSDPLFHLEHRGPVSMKGKKEP 598

  Fly   455 L----LQRSNLSTYLIRSRLPNFEDTDDLEDDN 483
            :    |.|.|..|          |:|:: ||:|
Mouse   599 MQVWFLSRKNTGT----------EETNE-EDEN 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 42/162 (26%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572
HNOBA 207..406 CDD:311573 24/108 (22%)
Guanylate_cyc 412..605 CDD:306677 47/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.