DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:113/254 - (44%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMPFTKTRHLFMEPHPEVSILEADMVDFTGLT 305
            |:..:||..|.|..:|..|.  :.|.|:         .||       :|:|:||.:|:|.||.:.
  Fly   433 KKNVSLLHLIFPAEIAEKLW--LGSSID---------AKT-------YPDVTILFSDIVGFTSIC 479

  Fly   306 TTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTCVTGI--PSYFPTHANACVNQALDMI 368
            :......::::|..|:..||...:.....:::.:||:|...:|:  .|.:..|..|.:  ||.||
  Fly   480 SRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWM--ALKMI 542

  Fly   369 EISREVSKRRNKKIDLRIGVHSGEILAGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRT 433
            :...:......::|.:|||:|:|.:|||::|....::.::...|.|.|:.||......:::|..|
  Fly   543 DACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPTT 607

  Fly   434 LGLLDNHYVYE------------------EGTDTA---------KLD---PLLQRSNLS 462
            ...|..|..:|                  .||:|.         .||   ||::..|:|
  Fly   608 KDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSELPLVEHINVS 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 41/157 (26%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 6/17 (35%)
CYCc 430..619 CDD:214485 53/205 (26%)
Guanylate_cyc 457..647 CDD:278633 49/207 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.