DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and CG42637

DIOPT Version :10

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_524165.2 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster


Alignment Length:240 Identity:60/240 - (25%)
Similarity:122/240 - (50%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 VYQNLVFQMAMKEEKALLDSIIPV--TLARSLQDAIASH----------IEEDPSNLMPFTKTRH 282
            |.:|.:.:|...:.|.::|.::.:  ..|.:|:|.:...          .|:....::|.:....
  Fly   816 VIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEK 880

  Fly   283 LFM----EP--HPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGD 341
            |.|    ||  :..|:|..:|:|.||.::.......:|..|::|:..||.........:::.:||
  Fly   881 LTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGD 945

  Fly   342 SYTCVTGIP-SYFPTHANACVNQALDMIEISRE--VSKRRNKKIDLRIGVHSGEILAGIIGLTKW 403
            :|..|:|:| .....||....:.||:::...::  ::.|.|:.:.||||:|:|.::||::|||..
  Fly   946 AYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMP 1010

  Fly   404 QFDIWSKDVDITNRLESSGLPGMVHISSR---TLGLLDNHYVYEE 445
            ::.::...|:..:|:||:|....:|||::   .|..|...|:.|:
  Fly  1011 RYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEK 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 AcyC 51..445 CDD:441717 59/238 (25%)
Nucleotidyl_cyc_III 283..439 CDD:448371 48/167 (29%)
AcyC 681..1076 CDD:441717
Nucleotidyl_cyc_III 841..1076 CDD:448371
CG42637NP_524165.2 PBP1_SAP_GC-like 26..445 CDD:380593
PK_GC-A_B 543..827 CDD:270944 3/10 (30%)
HNOBA <833..881 CDD:462234 6/47 (13%)
CYCc 860..1052 CDD:214485 50/191 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.