DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32301 and Phlpp

DIOPT Version :9

Sequence 1:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:360 Identity:68/360 - (18%)
Similarity:118/360 - (32%) Gaps:126/360 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MKEEKALLDSII----PVTL------ARSLQDAIASHIEED--PSNLMPFTKTRHL--------- 283
            ||:|:.:.||.:    ..||      ..|::.|...|:...  ||.:.|....|::         
  Fly   494 MKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAPSKVRPLKSKRYVLRMASTGGL 558

  Fly   284 ---FMEPHPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGDSYTC 345
               .:....::.:.:.|::....:.:..:...|     ||.:|.|               |.|..
  Fly   559 DAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVL-----ELILSND---------------DEYLV 603

  Fly   346 VTGIPSYFPTHANACVNQALDMIEISREVSKRRN------KKIDLRIGVHSGEILAGIIGLTKWQ 404
            |          .||.:...:|:...:||:.|..|      :.:|:.....:.|.|:.|:    .:
  Fly   604 V----------GNAQLWSVMDIDRAAREIRKEENSLLAAKRLVDIAQSFAAAESLSVIV----VR 654

  Fly   405 FDIWSKDVD-----ITNRLESSGLPGMVHISS-----RTLGLLDN---HYVYEEGTDTAKLDPLL 456
            |.....|||     :...:.....|..:.:||     ||.....|   |...|:       :||.
  Fly   655 FRHLGTDVDHLIRELKQSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQ-------EPLA 712

  Fly   457 QRSNLSTYLIRSRLPNFEDTDDL----EDDNFSLNDYRFSFSFSQDYEDIQVKAQRDMILEVEHM 517
            .||:          |:.:...||    :||.|.|...|.          :|.:.|.:|:.|.|.:
  Fly   713 GRSS----------PSGQSDRDLLAKDKDDEFVLAHARV----------LQEEQQLEMLDETESV 757

  Fly   518 PVNRVQTCKIRRPMHRIAKEDINEEYRFHLESYYL 552
                              .|.:..|.:|....|.|
  Fly   758 ------------------SESVLSEEQFKCWEYML 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 29/183 (16%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 34/194 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.